RegulonDB RegulonDB 10.9: Gene Form
   

aceA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aceK aceB aceA aceK-int arpA TSS_4837 TSS_4837 TSS_4836 TSS_4836

Gene      
Name: aceA    Texpresso search in the literature
Synonym(s): ECK4007, EG10022, b4015, icl
Genome position(nucleotides): 4217109 --> 4218413 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.33
Reference(s): [1] Matsuoka M., et al., 1988
[2] Rieul C., et al., 1988
External database links:  
ASAP:
ABE-0013128
CGSC:
1052
ECHOBASE:
EB0021
ECOLIHUB:
aceA
OU-MICROARRAY:
b4015
STRING:
511145.b4015
COLOMBOS: aceA


Product      
Name: isocitrate lyase
Synonym(s): AceA, Icl
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 47.522
Isoelectric point: 4.952
Motif(s):
 
Type Positions Sequence
338 -> 338 Q
91 -> 93 SGW
195 -> 195 C
219 -> 219 A
256 -> 434 ERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARRFAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWFNMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTSSVTALTGSTEESQF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.2 - glyoxylate bypass
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0043169 - cation binding
GO:0046872 - metal ion binding
GO:0004451 - isocitrate lyase activity
biological_process GO:0019752 - carboxylic acid metabolic process
GO:0006097 - glyoxylate cycle
GO:0006099 - tricarboxylic acid cycle
External database links:  
DIP:
DIP-35893N
ECOCYC:
ISOCIT-LYASE-MONOMER
ECOLIWIKI:
b4015
INTERPRO:
IPR018523
INTERPRO:
IPR040442
INTERPRO:
IPR039556
INTERPRO:
IPR015813
INTERPRO:
IPR006254
MODBASE:
P0A9G6
PANTHER:
PTHR21631
PDB:
1IGW
PFAM:
PF00463
PRIDE:
P0A9G6
PRODB:
PRO_000022036
PROSITE:
PS00161
REFSEQ:
NP_418439
SMR:
P0A9G6
UNIPROT:
P0A9G6


Operon      
Name: aceBAK         
Operon arrangement:
Transcription unit        Promoter
aceBAK
aceK


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, Cra
Repressed by: CRP, IclR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4836 4217043 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4837 4217361 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Matsuoka M., McFadden BA., 1988, Isolation, hyperexpression, and sequencing of the aceA gene encoding isocitrate lyase in Escherichia coli., J Bacteriol 170(10):4528-36

 [2] Rieul C., Bleicher F., Duclos B., Cortay JC., Cozzone AJ., 1988, Nucleotide sequence of the aceA gene coding for isocitrate lyase in Escherichia coli., Nucleic Acids Res 16(12):5689

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB