RegulonDB RegulonDB 11.0: Gene Form
   

aceE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aceE aceF pdhR tp2 NsrR TSS_247 TSS_247 TSS_246 TSS_246 TSS_245 TSS_245 TSS_244 TSS_244 TSS_243 TSS_243 TSS_242 (cluster) TSS_242 (cluster) TSS_241 TSS_241 aceEp2 aceEp2 aceEp1 aceEp1 TSS_239 TSS_239 TSS_238 TSS_238

Gene      
Name: aceE    Texpresso search in the literature
Synonym(s): ECK0113, EG10024, b0114
Genome position(nucleotides): 123017 --> 125680
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.04
External database links:  
ASAP:
ABE-0000397
CGSC:
1050
ECHOBASE:
EB0023
ECOLIHUB:
aceE
OU-MICROARRAY:
b0114
STRING:
511145.b0114
COLOMBOS: aceE


Product      
Name: pyruvate dehydrogenase E1 component
Synonym(s): AceE, subunit of E1p component of pyruvate dehydrogenase complex
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 99.668
Isoelectric point: 5.423
Motif(s):
 
Type Positions Sequence Comment
2 -> 887 SERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEARKGGVNVAAGTGISNYINTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLELGGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEGIFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFGKYPETAALVADWTDEQIWALNRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGDAAEGKNIAHQVKKMNMDGVRHIRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQKLHGYLPSRQPNFTEKLELPSLQDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGCSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMPAMPEGAEEGIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAEILAKDYGVGSDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQVRTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADAIAKFNIDADKVNPRLA UniProt: Pyruvate dehydrogenase E1 component.
106 -> 296 GHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSKQTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEGIFEGAGWNVIKVMWG
146 -> 146 P UniProt: In Ref. 1; CAA24740..
276 -> 276 I UniProt: In Ref. 1; CAA24740..
489 -> 700 QSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGCSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLNENYHMP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.3 - pyruvate dehydrogenase
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.21 - glyoxylate degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0045250 - cytosolic pyruvate dehydrogenase complex
GO:0045254 - pyruvate dehydrogenase complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004738 - pyruvate dehydrogenase activity
GO:0004739 - pyruvate dehydrogenase (acetyl-transferring) activity
GO:0000287 - magnesium ion binding
GO:0030976 - thiamine pyrophosphate binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006096 - glycolytic process
GO:0042867 - pyruvate catabolic process
Reference(s): [1] Graham LD., et al., 1989
[2] Stephens PE., et al., 1983
External database links:  
ALPHAFOLD:
P0AFG8
DIP:
DIP-9039N
DISPROT:
DP00427
ECOCYC:
E1P-MONOMER
ECOLIWIKI:
b0114
INTERPRO:
IPR029061
INTERPRO:
IPR035807
INTERPRO:
IPR004660
INTERPRO:
IPR005474
INTERPRO:
IPR009014
INTERPRO:
IPR041621
PANTHER:
PTHR43825:SF3
PDB:
2QTC
PDB:
2QTA
PDB:
2G67
PDB:
2G28
PDB:
2G25
PDB:
1RP7
PDB:
1L8A
PDB:
2IEA
PFAM:
PF17831
PFAM:
PF00456
PRIDE:
P0AFG8
PRODB:
PRO_000022038
REFSEQ:
NP_414656
SMR:
P0AFG8
SWISSMODEL:
P0AFG8
UNIPROT:
P0AFG8


Operon      
Name: pdhR-aceEF-lpd         
Operon arrangement:
Transcription unit        Promoter
pdhR-aceEF-lpdA
pdhR-aceEF-lpdA
aceEF
aceEF
lpdA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR
Repressed by: NsrR, FNR, Cra, ArcA, PdhR, BtsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_238 122852 forward nd [RS-EPT-CBR] [3]
  promoter TSS_239 122860 forward nd [RS-EPT-CBR] [3]
  promoter TSS_241 123388 forward nd [RS-EPT-CBR] [3]
  promoter TSS_242 (cluster) 123471 forward nd [RS-EPT-CBR] [3]
  promoter TSS_243 124973 forward nd [RS-EPT-CBR] [3]
  promoter TSS_244 125226 forward nd [RS-EPT-CBR] [3]
  promoter TSS_245 125425 forward nd [RS-EPT-CBR] [3]
  promoter TSS_246 127432 forward nd [RS-EPT-CBR] [3]
  promoter TSS_247 127436 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Graham LD., Packman LC., Perham RN., 1989, Kinetics and specificity of reductive acylation of lipoyl domains from 2-oxo acid dehydrogenase multienzyme complexes., Biochemistry 28(4):1574-81

 [2] Stephens PE., Darlison MG., Lewis HM., Guest JR., 1983, The pyruvate dehydrogenase complex of Escherichia coli K12. Nucleotide sequence encoding the pyruvate dehydrogenase component., Eur J Biochem 133(1):155-62

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB