RegulonDB RegulonDB 10.9: Gene Form
   

aceK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arpA aceK aceA aceK-int TSS_4837 TSS_4837

Gene      
Name: aceK    Texpresso search in the literature
Synonym(s): ECK4008, EG10026, b4016
Genome position(nucleotides): 4218596 --> 4220332 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.79
External database links:  
ASAP:
ABE-0013131
CGSC:
17770
ECHOBASE:
EB0025
ECOLIHUB:
aceK
OU-MICROARRAY:
b4016
STRING:
511145.b4016
COLOMBOS: aceK


Product      
Name: isocitrate dehydrogenase kinase/phosphatase
Synonym(s): AceK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 67.699
Isoelectric point: 6.478
Motif(s):
 
Type Positions Sequence
140 -> 140 A
315 -> 321 APGIRGM
9 -> 566 IAQTILQGFDAQYGRFLEVTSGAQQRFEQADWHAVQQAMKNRIHLYDHHVGLVVEQLRCITNGQSTDAAFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPERLFIFSSQPERRFRTIPRPLAKDFHPDHGWESLLMRVISDLPLRLRWQNKSRDIHYIIRHLTETLGTDNLAESHLQVANELFYRNKAAWLVGKLITPSGTLPFLLPIHQTDDGELFIDTCLTTTAEASIVFGFARSYFMVYAPLPAALVEWLREILPGKTTAELYMAIGCQKHAKTESYREYLVYLQGCNEQFIEAPGIRGMVMLVFTLPGFDRVFKVIKDRFAPQKEMSAAHVRACYQLVKEHDRVGRMADTQEFENFVLEKRHISPALMELLLQEAAEKITDLGEQIVIRHLYIERRMVPLNIWLEQVEGQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDELASEPWYSVSPGDVFPEEFRHWLCADPRIGPLFEEMHADLFRADYWRALQNRIREGHVEDVYAYRRR
336 -> 336 K
377 -> 377 N

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.2 - glyoxylate bypass
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016788 - hydrolase activity, acting on ester bonds
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0016791 - phosphatase activity
GO:0004674 - protein serine/threonine kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008772 - [isocitrate dehydrogenase (NADP+)] kinase activity
GO:0016208 - AMP binding
GO:0004722 - protein serine/threonine phosphatase activity
biological_process GO:0070262 - peptidyl-serine dephosphorylation
GO:0006006 - glucose metabolic process
GO:0006097 - glyoxylate cycle
GO:0006099 - tricarboxylic acid cycle
GO:0006470 - protein dephosphorylation
GO:0016310 - phosphorylation
GO:0050790 - regulation of catalytic activity
GO:0018105 - peptidyl-serine phosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9041N
ECOCYC:
ICITDEHASE-KIN-PHOSPHA
ECOLIWIKI:
b4016
INTERPRO:
IPR010452
PANTHER:
PTHR39559
PDB:
6K5L
PFAM:
PF06315
PRIDE:
P11071
PRODB:
PRO_000022040
REFSEQ:
NP_418440
SMR:
P11071
UNIPROT:
P11071


Operon      
Name: aceBAK         
Operon arrangement:
Transcription unit        Promoter
aceBAK
aceK


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, Cra
Repressed by: CRP, IclR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4837 4217361 forward nd [RS-EPT-CBR] [1]
  promoter arpAp8 4222513 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter arpAp1 4222629 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter arpAp9 4222691 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB