RegulonDB RegulonDB 10.8: Gene Form
   

ascB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ascF ascB hycI hycH ascBp ascBp

Gene      
Name: ascB    Texpresso search in the literature
Synonym(s): ECK2711, EG10085, b2716, sac
Genome position(nucleotides): 2840990 --> 2842414 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.51
External database links:  
ASAP:
ABE-0008928
CGSC:
33236
ECHOBASE:
EB0083
OU-MICROARRAY:
b2716
PortEco:
ascB
STRING:
511145.b2716
COLOMBOS: ascB


Product      
Name: 6-phospho-β-glucosidase AscB
Synonym(s): AscB, Sac
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.935
Isoelectric point: 5.499
Motif(s):
 
Type Positions Sequence
405 -> 406 EA
3 -> 470 VFPESFLWGGALAANQSEGAFREGDKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEFYPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDEITPNQQGIAFYRSVFEECKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNEINIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGGNFYPYSCKPEDVWAALEKDRENLFFIDVQARGTYPAYSARVFREKGVTINKAPGDDEILKNTVDFVSFSYYASRCASAEMNANNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMMYDRYQKPLFLVENGLGAKDEFAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWGCIDLVSASTGEMSKRYGFVFVDRDDAGNGTLTRTRKKSFWWYKKVIASNG
455 -> 456 RK
428 -> 428 S

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0103047 - methyl beta-D-glucoside 6-phosphate glucohydrolase activity
GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0008422 - beta-glucosidase activity
GO:0008706 - 6-phospho-beta-glucosidase activity
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0016052 - carbohydrate catabolic process
GO:2000892 - cellobiose catabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH1
ECOCYC:
EG10085-MONOMER
ECOLIWIKI:
b2716
INTERPRO:
IPR018120
INTERPRO:
IPR033132
INTERPRO:
IPR017853
INTERPRO:
IPR001360
MODBASE:
P24240
PANTHER:
PTHR10353
PFAM:
PF00232
PRIDE:
P24240
PRINTS:
PR00131
PRODB:
PRO_000022161
PROSITE:
PS00572
PROSITE:
PS00653
REFSEQ:
NP_417196
SMR:
P24240
UNIPROT:
P24240


Operon      
Name: ascFB         
Operon arrangement:
Transcription unit        Promoter
ascFB
ascB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: AscG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB