RegulonDB RegulonDB 10.8: Gene Form
   

ascF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ascF ascB ascG AscG AscG CRP anti-anti-terminator anti-terminator terminator ascBp ascBp ascFp ascFp TSS_3020 TSS_3020 ascGp ascGp

Gene      
Name: ascF    Texpresso search in the literature
Synonym(s): ECK2710, EG10086, b2715, sac
Genome position(nucleotides): 2839524 --> 2840981 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.1
External database links:  
ASAP:
ABE-0008926
CGSC:
33233
ECHOBASE:
EB0084
OU-MICROARRAY:
b2715
PortEco:
ascF
STRING:
511145.b2715
COLOMBOS: ascF


Product      
Name: β-glucoside specific PTS enzyme IIBC component
Synonym(s): AscF, Sac
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 51.026
Isoelectric point: 9.092
Motif(s):
 
Type Positions Sequence
108 -> 470 DALIGTMSPLIPAIIGGSMVKLLAMILEMSGVLTKGSPTLTILNVIGDGAFFFLPLMVAASAAIKFKTNMSLAIAIAGVLVHPSFIELMAKAAQGEHVEFALIPVTAVKYTYTVIPALVMTWCLSYIERWVDSITPAVTKNFLKPMLIVLIAAPLAILLIGPIGIWIGSAISALVYTIHGYLGWLSVAIMGALWPLLVMTGMHRVFTPTIIQTIAETGKEGMVMPSEIGANLSLGGSSLAVAWKTKNPELRQTALAAAASAIMAGISEPALYGVAIRLKRPLIASLISGFICGAVAGMAGLASHSMAAPGLFTSVQFFDPANPMSIVWVFAVMALAVVLSFILTLLLGFEDIPVEEAAAQARK
147 -> 167 LTILNVIGDGAFFFLPLMVAA
433 -> 453 IVWVFAVMALAVVLSFILTLL
1 -> 88 MAKNYAALARSVIAALGGVDNISAVTHCMTRLRFVIKDDALIDSPTLKTIPGVLGVVRSDNQCQVIIGNTVSQAFQEVVSLLPGDMQP
102 -> 122 IGAGILDALIGTMSPLIPAII

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
External database links:  
ECOCYC:
ASCF-MONOMER
ECOLIWIKI:
b2715
INTERPRO:
IPR004719
INTERPRO:
IPR036878
INTERPRO:
IPR018113
INTERPRO:
IPR013013
INTERPRO:
IPR003352
INTERPRO:
IPR001996
MODBASE:
P24241
PFAM:
PF02378
PFAM:
PF00367
PRIDE:
P24241
PRODB:
PRO_000022162
PROSITE:
PS51103
PROSITE:
PS51098
PROSITE:
PS01035
REFSEQ:
YP_026182
SMR:
P24241
UNIPROT:
P24241


Operon      
Name: ascFB         
Operon arrangement:
Transcription unit        Promoter
ascFB
ascB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: AscG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ascGp 2839287 reverse nd [AIPP] [1]
  promoter TSS_3020 2839288 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [AIPP] Automated inference of promoter position

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hall BG., Xu L., 1992, Nucleotide sequence, function, activation, and evolution of the cryptic asc operon of Escherichia coli K12., Mol Biol Evol 9(4):688-706

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB