RegulonDB RegulonDB 10.9: Gene Form
   

atpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

atpA atpG atpH TSS_4322 TSS_4322 TSS_4321 (cluster) TSS_4321 (cluster) TSS_4320 TSS_4320 TSS_4319 TSS_4319 TSS_4318 TSS_4318 TSS_4317 TSS_4317 TSS_4316 TSS_4316 TSS_4315 TSS_4315 TSS_4314 TSS_4314 TSS_4313 TSS_4313 TSS_4312 TSS_4312 TSS_4311 TSS_4311 TSS_4310 (cluster) TSS_4310 (cluster) TSS_4309 TSS_4309 TSS_4308 TSS_4308 TSS_4307 TSS_4307 TSS_4306 TSS_4306 TSS_4305 (cluster) TSS_4305 (cluster) TSS_4304 (cluster) TSS_4304 (cluster) TSS_4303 TSS_4303 TSS_4302 TSS_4302

Gene      
Name: atpA    Texpresso search in the literature
Synonym(s): ECK3727, EG10098, b3734, papA, uncA
Genome position(nucleotides): 3918316 <-- 3919857 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.37
External database links:  
ASAP:
ABE-0012213
CGSC:
33
ECHOBASE:
EB0096
ECOLIHUB:
atpA
MIM:
615228
MIM:
616045
OU-MICROARRAY:
b3734
STRING:
511145.b3734
COLOMBOS: atpA


Product      
Name: ATP synthase F1 complex subunit α
Synonym(s): AtpA, PapA, UncA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.222
Isoelectric point: 5.982
Motif(s):
 
Type Positions Sequence
169 -> 176 GDRQTGKT
29 -> 92 GTIVSVSDGVIRIHGLADCMQGEMISLPGNRYAIALNLERDSVGAVVMGPYADLAEGMKVKCTG
239 -> 244 PYAGCA
382 -> 507 QTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHAPLMQEINQTGGYNDEIEGKLKGILDSF
149 -> 375 GYKAVDSMIPIGRGQRELIIGDRQTGKTALAIDAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPYAGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLERAARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLFNAGIRPAVNPGISVS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.8 - ATP proton motive force interconversion
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.2 - The H+- or Na+-translocating F-type, V-type and A-type ATPase (F-ATPase) Su
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0045261 - proton-transporting ATP synthase complex, catalytic core F(1)
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0046933 - proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 - proton-transporting ATPase activity, rotational mechanism
GO:0032559 - adenyl ribonucleotide binding
GO:0043531 - ADP binding
biological_process GO:0006754 - ATP biosynthetic process
GO:0006811 - ion transport
GO:0015986 - ATP synthesis coupled proton transport
GO:0046034 - ATP metabolic process
GO:1902600 - proton transmembrane transport
External database links:  
DIP:
DIP-31845N
ECOCYC:
ATPA-MONOMER
ECOLIWIKI:
b3734
INTERPRO:
IPR033732
INTERPRO:
IPR038376
INTERPRO:
IPR036121
INTERPRO:
IPR027417
INTERPRO:
IPR023366
INTERPRO:
IPR020003
INTERPRO:
IPR005294
INTERPRO:
IPR004100
INTERPRO:
IPR000793
INTERPRO:
IPR000194
MINT:
P0ABB0
MODBASE:
P0ABB0
PDB:
5T4O
PDB:
3OAA
PDB:
1D8S
PDB:
5T4P
PDB:
5T4Q
PFAM:
PF00006
PFAM:
PF00306
PFAM:
PF02874
PRIDE:
P0ABB0
PRODB:
PRO_000022186
PROSITE:
PS00152
REFSEQ:
NP_418190
SMR:
P0ABB0
SWISSMODEL:
P0ABB0
UNIPROT:
P0ABB0


Operon      
Name: atpIBEFHAGDC         
Operon arrangement:
Transcription unit        Promoter
atpBEFHAGDC
atpBEFHAGDC
atpIBEFHAGDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4302 3917446 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4303 3917736 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4304 (cluster) 3917740 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4305 (cluster) 3917744 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4306 3917765 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4307 3918078 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4308 3918597 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4309 3918988 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4310 (cluster) 3919083 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4311 3919085 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4312 3919114 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4313 3919282 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4314 3919287 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4315 3919409 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4316 3919427 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4317 3919430 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4318 3919444 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4319 3919510 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4320 3919515 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4321 (cluster) 3919763 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4322 3919977 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB