RegulonDB RegulonDB 10.9: Gene Form
   

atpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

atpD glmU atpC NagC NagC TSS_4300 TSS_4300 TSS_4299 (cluster) TSS_4299 (cluster) TSS_4298 TSS_4298 TSS_4297 TSS_4297 TSS_4296 TSS_4296 TSS_4295 TSS_4295 TSS_4294 TSS_4294 atpCp1 atpCp1 TSS_4293 TSS_4293 glmUp2 glmUp2 glmUp1 glmUp1 TSS_4291 (cluster) TSS_4291 (cluster) TSS_4290 TSS_4290 TSS_4289 TSS_4289 TSS_4288 TSS_4288 TSS_4287 TSS_4287

Gene      
Name: atpC    Texpresso search in the literature
Synonym(s): ECK3724, EG10100, b3731, papG, uncC
Genome position(nucleotides): 3915553 <-- 3915972 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.24
External database links:  
ASAP:
ABE-0012206
CGSC:
31
ECHOBASE:
EB0098
ECOLIHUB:
atpC
OU-MICROARRAY:
b3731
STRING:
511145.b3731
COLOMBOS: atpC


Product      
Name: ATP synthase F1 complex subunit ε
Synonym(s): ATP synthase F1 complex - epsilon subunit, AtpC, PapG, UncC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.068
Isoelectric point: 5.537
Motif(s):
 
Type Positions Sequence
6 -> 84 HLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTA
13 -> 13 E
2 -> 139 AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM
89 -> 133 DLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.8 - ATP proton motive force interconversion
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.2 - The H+- or Na+-translocating F-type, V-type and A-type ATPase (F-ATPase) Su
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0045261 - proton-transporting ATP synthase complex, catalytic core F(1)
molecular_function GO:0005515 - protein binding
GO:0005524 - ATP binding
GO:0046933 - proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 - proton-transporting ATPase activity, rotational mechanism
biological_process GO:0006754 - ATP biosynthetic process
GO:0006811 - ion transport
GO:0015986 - ATP synthesis coupled proton transport
Note(s): Note(s): ...[more].
Reference(s): [1] Bulygin VV., et al., 2004
[2] Iino R., et al., 2009
[3] Jindal S., et al., 2019
[4] Krah A., et al., 2018
[5] Milgrom YM., et al., 2020
[6] Nakanishi-Matsui M., et al., 2016
[7] Nakanishi-Matsui M., et al., 2014
[8] Sielaff H., et al., 2018
External database links:  
DIP:
DIP-47828N
ECOCYC:
ATPC-MONOMER
ECOLIWIKI:
b3731
INTERPRO:
IPR001469
INTERPRO:
IPR036794
INTERPRO:
IPR020546
INTERPRO:
IPR020547
INTERPRO:
IPR036771
PANTHER:
PTHR13822
PDB:
5T4Q
PDB:
5T4P
PDB:
5T4O
PDB:
1AQT
PDB:
1BSH
PDB:
1BSN
PDB:
1FS0
PDB:
1QO1
PDB:
3OAA
PFAM:
PF00401
PFAM:
PF02823
PRIDE:
P0A6E6
PRODB:
PRO_000022188
REFSEQ:
NP_418187
SMR:
P0A6E6
UNIPROT:
P0A6E6


Operon      
Name: atpIBEFHAGDC         
Operon arrangement:
Transcription unit        Promoter
atpBEFHAGDC
atpBEFHAGDC
atpIBEFHAGDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4287 3913867 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4288 3913870 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4289 3914025 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4290 3915218 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4291 (cluster) 3915222 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_4293 3915989 reverse nd [RS-EPT-CBR] [9]
  promoter atpCp1 3916059 reverse Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter TSS_4294 3916641 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4295 3916759 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4296 3916978 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4297 3917001 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4298 3917107 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_4299 (cluster) 3917272 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_4300 3917275 reverse nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bulygin VV., Duncan TM., Cross RL., 2004, Rotor/Stator interactions of the epsilon subunit in Escherichia coli ATP synthase and implications for enzyme regulation., J Biol Chem 279(34):35616-21

 [2] Iino R., Hasegawa R., Tabata KV., Noji H., 2009, Mechanism of inhibition by C-terminal alpha-helices of the epsilon subunit of Escherichia coli FoF1-ATP synthase., J Biol Chem 284(26):17457-64

 [3] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [4] Krah A., Zarco-Zavala M., McMillan DGG., 2018, Insights into the regulatory function of the ε subunit from bacterial F-type ATP synthases: a comparison of structural, biochemical and biophysical data., Open Biol 8(5)

 [5] Milgrom YM., Duncan TM., 2020, F-ATP-ase of Escherichia coli membranes: The ubiquitous MgADP-inhibited state and the inhibited state induced by the ε-subunit's C-terminal domain are mutually exclusive., Biochim Biophys Acta Bioenerg 1861(7):148189

 [6] Nakanishi-Matsui M., Sekiya M., Futai M., 2016, ATP synthase from Escherichia coli: Mechanism of rotational catalysis, and inhibition with the ε subunit and phytopolyphenols., Biochim Biophys Acta 1857(2):129-140

 [7] Nakanishi-Matsui M., Sekiya M., Yano S., Futai M., 2014, Inhibition of F1-ATPase rotational catalysis by the carboxyl-terminal domain of the ϵ subunit., J Biol Chem 289(44):30822-31

 [8] Sielaff H., Duncan TM., Borsch M., 2018, The regulatory subunit ε in Escherichia coli FO F1 -ATP synthase., Biochim Biophys Acta Bioenerg 1859(9):775-788

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [10] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB