RegulonDB RegulonDB 10.9: Gene Form
   

atpF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

atpH atpF atpE TSS_4329 TSS_4329 TSS_4328 TSS_4328 TSS_4327 TSS_4327 TSS_4326 TSS_4326 TSS_4325 TSS_4325 TSS_4324 TSS_4324 TSS_4323 (cluster) TSS_4323 (cluster) TSS_4322 TSS_4322

Gene      
Name: atpF    Texpresso search in the literature
Synonym(s): ECK3729, EG10103, b3736, papF, uncF
Genome position(nucleotides): 3920418 <-- 3920888 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.87
External database links:  
ASAP:
ABE-0012217
CGSC:
28
ECHOBASE:
EB0101
ECOLIHUB:
atpF
OU-MICROARRAY:
b3736
STRING:
511145.b3736
COLOMBOS: atpF


Product      
Name: ATP synthase Fo complex subunit b
Synonym(s): ATP synthase Fo complex - b subunit, AtpF, B chain, PapF, UncF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.264
Isoelectric point: 6.046
Motif(s):
 
Type Positions Sequence
33 -> 33 I
11 -> 31 AIAFVLFVLFCMKYVWPPLMA
62 -> 62 T
72 -> 72 A
6 -> 137 TILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.8 - ATP proton motive force interconversion
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.2 - The H+- or Na+-translocating F-type, V-type and A-type ATPase (F-ATPase) Su
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0045263 - proton-transporting ATP synthase complex, coupling factor F(o)
molecular_function GO:0015078 - proton transmembrane transporter activity
GO:0046933 - proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 - proton-transporting ATPase activity, rotational mechanism
biological_process GO:0006754 - ATP biosynthetic process
GO:0006811 - ion transport
GO:0015986 - ATP synthesis coupled proton transport
External database links:  
DIP:
DIP-35994N
ECOCYC:
ATPF-MONOMER
ECOLIWIKI:
b3736
INTERPRO:
IPR028987
INTERPRO:
IPR005864
INTERPRO:
IPR002146
MODBASE:
P0ABA0
PDB:
5T4Q
PDB:
1B9U
PDB:
5T4P
PDB:
1L2P
PDB:
5T4O
PDB:
2KHK
PFAM:
PF00430
PRIDE:
P0ABA0
PRODB:
PRO_000022191
REFSEQ:
NP_418192
SMR:
P0ABA0
UNIPROT:
P0ABA0


Operon      
Name: atpIBEFHAGDC         
Operon arrangement:
Transcription unit        Promoter
atpBEFHAGDC
atpBEFHAGDC
atpIBEFHAGDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4322 3919977 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4323 (cluster) 3920436 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4324 3920475 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4325 3920485 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4326 3920588 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4327 3920598 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4328 3920997 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4329 3921003 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB