RegulonDB RegulonDB 10.7: Gene Form
   

bcp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dapA hyfA gcvR bcp FNR FhlA HyfR CRP hyfAp hyfAp bcpp bcpp TSS_2774 TSS_2774 TSS_2773 TSS_2773 gcvRp gcvRp gcvRp2 gcvRp2 dapAp dapAp TSS_2770 TSS_2770 TSS_2769 TSS_2769 bamCp bamCp

Gene      
Name: bcp    Texpresso search in the literature
Synonym(s): ECK2476, EG10108, b2480
Genome position(nucleotides): 2600478 --> 2600948 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.47
External database links:  
ASAP:
ABE-0008171
CGSC:
33035
ECHOBASE:
EB0106
OU-MICROARRAY:
b2480
PORTECO:
bcp
REGULONDB:
b2480
STRING:
511145.b2480
M3D: bcp
COLOMBOS: bcp
PortEco: b2480


Product      
Name: thiol peroxidase
Synonym(s): Bcp
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.634
Isoelectric point: 4.851
Motif(s):
 
Type Positions Sequence
7 -> 134 GDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEH
4 -> 156 LKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKEHA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0016209 - antioxidant activity
GO:0008379 - thioredoxin peroxidase activity
GO:0051920 - peroxiredoxin activity
GO:0032843 - hydroperoxide reductase activity
biological_process GO:0006979 - response to oxidative stress
GO:0045454 - cell redox homeostasis
GO:0055114 - oxidation-reduction process
GO:0034599 - cellular response to oxidative stress
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10108-MONOMER
ECOLIWIKI:
b2480
INTERPRO:
IPR000866
INTERPRO:
IPR013766
INTERPRO:
IPR024706
INTERPRO:
IPR036249
MODBASE:
P0AE52
PFAM:
PF00578
PRIDE:
P0AE52
PROSITE:
PS51352
PROTEINMODELPORTAL:
P0AE52
REFSEQ:
NP_416975
SMR:
P0AE52
SWISSMODEL:
P0AE52
UNIPROT:
P0AE52


Operon      
Name: bcp         
Operon arrangement:
Transcription unit        Promoter
bcp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2769 2599483 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2770 2599588 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2773 2600100 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2774 2600225 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB