RegulonDB RegulonDB 10.7: Gene Form
   

bioC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bioF bioB bioC bioD ybhU LexA DnaA DnaA LexA DnaA uvrBp3 uvrBp3

Gene      
Name: bioC    Texpresso search in the literature
Synonym(s): ECK0766, EG10119, b0777
Genome position(nucleotides): 811522 --> 812277 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.48
External database links:  
ASAP:
ABE-0002648
CGSC:
957
ECHOBASE:
EB0117
MIM:
252010
MIM:
256000
OU-MICROARRAY:
b0777
PORTECO:
bioC
REGULONDB:
b0777
STRING:
511145.b0777
M3D: bioC
COLOMBOS: bioC
PortEco: b0777


Product      
Name: malonyl-acyl carrier protein methyltransferase
Synonym(s): BioC, malonyl-[acp] methyltransferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.276
Isoelectric point: 8.287
Motif(s):
 
Type Positions Sequence
47 -> 138 LDAGCGPGWMSRHWRERHAQVTALDLSPPMLVQARQKDAADHYLAGDIESLPLATATFDLAWSNLAVQWCGNLSTALRELYRVVRPKGVVAF
149 -> 149 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.1 - biotin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0102130 - malonyl-CoA methyltransferase activity
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0010340 - carboxyl-O-methyltransferase activity
biological_process GO:0009102 - biotin biosynthetic process
GO:0032259 - methylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10119-MONOMER
ECOLIWIKI:
b0777
INTERPRO:
IPR011814
INTERPRO:
IPR013216
INTERPRO:
IPR029063
MODBASE:
P12999
PFAM:
PF08241
PRIDE:
P12999
PRODB:
PRO_000022223
PROTEINMODELPORTAL:
P12999
REFSEQ:
NP_415298
SMR:
P12999
UNIPROT:
P12999


Operon      
Name: bioBFCD         
Operon arrangement:
Transcription unit        Promoter
bioBFCD


Transcriptional Regulation      
Display Regulation             
Repressed by: BirA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB