RegulonDB RegulonDB 10.10: Gene Form
   

bioH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpnA bioH yhgH GntR CRP nfuAp2 nfuAp2 TSS_4011 TSS_4011 bioHp bioHp gntXp gntXp

Gene      
Name: bioH    Texpresso search in the literature
Synonym(s): ECK3399, EG10122, b3412, bioB
Genome position(nucleotides): 3544074 <-- 3544844 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.16
External database links:  
ASAP:
ABE-0011136
CGSC:
954
ECHOBASE:
EB0120
ECOLIHUB:
bioH
OU-MICROARRAY:
b3412
STRING:
511145.b3412
COLOMBOS: bioH


Product      
Name: pimeloyl-acyl carrier protein methyl ester esterase
Synonym(s): BioB, BioH, pimeloyl-[acp] methyl ester esterase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.505
Isoelectric point: 7.015
Motif(s):
 
Type Positions Sequence
143 -> 147 FLALQ
15 -> 242 HLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFISHP
82 -> 82 S

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.1 - biotin
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0052689 - carboxylic ester hydrolase activity
GO:0090499 - pimelyl-[acyl-carrier protein] methyl ester esterase activity
biological_process GO:0009102 - biotin biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9223N
ECOCYC:
EG10122-MONOMER
ECOLIWIKI:
b3412
INTERPRO:
IPR029058
INTERPRO:
IPR010076
INTERPRO:
IPR000073
MODBASE:
P13001
PDB:
1M33
PFAM:
PF00561
PRIDE:
P13001
PRODB:
PRO_000022226
REFSEQ:
NP_417871
SMR:
P13001
UNIPROT:
P13001


Operon      
Name: bioH         
Operon arrangement:
Transcription unit        Promoter
bioH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4011 3544875 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB