RegulonDB RegulonDB 10.8: Gene Form
   

carA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

carB carA dapB nc9 ArgR ArgR Fis PepA Fis PurR Fis PepA RutR IHF TSS_78 TSS_78 TSS_77 TSS_77 carBp carBp carAp2 carAp2 carAp1 carAp1

Gene      
Name: carA    Texpresso search in the literature
Synonym(s): ECK0033, EG10134, arg, b0032, cap, pyrA
Genome position(nucleotides): 29651 --> 30799 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.35
External database links:  
ASAP:
ABE-0000118
CGSC:
936
ECHOBASE:
EB0132
NCBI-GENE:
949025
OU-MICROARRAY:
b0032
PortEco:
carA
STRING:
511145.b0032
COLOMBOS: carA


Product      
Name: carbamoyl phosphate synthetase subunit α
Synonym(s): alpha; chain, Arg, Cap, CarA, PyrA, carbamoyl phosphate synthetase, alpha; chain, small chain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.431
Isoelectric point: 6.338
Motif(s):
 
Type Positions Sequence
193 -> 380 HVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKT
5 -> 132 ALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCI
1 -> 189 MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDE
197 -> 372 YDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.2 - pyrimidine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005951 - carbamoyl-phosphate synthase complex
molecular_function GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004088 - carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
biological_process GO:0006221 - pyrimidine nucleotide biosynthetic process
GO:0006526 - arginine biosynthetic process
GO:0006541 - glutamine metabolic process
GO:0006807 - nitrogen compound metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0006207 - 'de novo' pyrimidine nucleobase biosynthetic process
GO:0044205 - 'de novo' UMP biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Blank D., et al., 2014
External database links:  
DIP:
DIP-35412N
ECOCYC:
CARBPSYN-SMALL
ECOLIWIKI:
b0032
INTERPRO:
IPR036480
INTERPRO:
IPR029062
INTERPRO:
IPR035686
INTERPRO:
IPR017926
INTERPRO:
IPR006274
INTERPRO:
IPR002474
MODBASE:
P0A6F1
PDB:
1JDB
PDB:
1KEE
PDB:
1M6V
PDB:
1T36
PDB:
1CS0
PDB:
1CE8
PDB:
1C3O
PDB:
1C30
PDB:
1BXR
PDB:
1A9X
PFAM:
PF00988
PFAM:
PF00117
PRIDE:
P0A6F1
PRODB:
PRO_000022247
PROSITE:
PS51273
REFSEQ:
NP_414573
SMART:
SM01097
SMR:
P0A6F1
UNIPROT:
P0A6F1


Operon      
Name: carAB         
Operon arrangement:
Transcription unit        Promoter
carAB
carAB
carB


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, Fis, RutR
Repressed by: PurR, IHF, ArgR, PepA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_77 31596 forward nd [RS-EPT-CBR] [2]
  promoter TSS_78 31603 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Blank D., Wolf L., Ackermann M., Silander OK., 2014, The predictability of molecular evolution during functional innovation., Proc Natl Acad Sci U S A 111(8):3044-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB