RegulonDB RegulonDB 10.9: Gene Form
   

clpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clpB rrsG pgeF ryfD rluD Fis Fis Fis RyfD DksA DksA-ppGpp DksA-ppGpp ppGpp ryfDp ryfDp TSS_2908 (cluster) TSS_2908 (cluster) TSS_2907 TSS_2907 clpBp clpBp TSS_2905 TSS_2905 TSS_2904 (cluster) TSS_2904 (cluster) TSS_2903 (cluster) TSS_2903 (cluster) rrsGp1 rrsGp1 rrsGp2 rrsGp2 TSS_2902 TSS_2902

Gene      
Name: clpB    Texpresso search in the literature
Synonym(s): ECK2590, EG10157, b2592, htpM
Genome position(nucleotides): 2731600 <-- 2734173 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.44
Reference(s): [1] Park SK., et al., 1993
External database links:  
ASAP:
ABE-0008527
CGSC:
32875
ECHOBASE:
EB0155
ECOLIHUB:
clpB
MIM:
616271
OU-MICROARRAY:
b2592
STRING:
511145.b2592
COLOMBOS: clpB


Shine dalgarno      
Sequence: gatccgttatGGGAGGagtTAT


Product      
Name: chaperone protein ClpB
Synonym(s): ClpB, ClpB95, E89, F68.5, F84.1, HtpM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 95.585
Isoelectric point: 5.194
Motif(s):
 
Type Positions Sequence
7 -> 7 T
94 -> 145 CDKLAQKRGDNFISSELFVLAALESRGTLADILKAAGATTANITQAIEQMRG
96 -> 97 KL
341 -> 545 PSVEDTIAILRGLKERYELHHHVQITDPAIVAAATLSHRYIADRQLPDKAIDLIDEAASSIRMQIDSKPEELDRLDRRIIQLKLEQQALMKESDEASKKRLDMLNEELSDKERQYSELEEEWKAEKASLSGTQTIKAELEQAKIAIEQARRVGDLARMSELQYGKIPELEKQLEAATQLEGKTMRLLRNKVTDAEIAEVLARWTG
596 -> 760 RPIGSFLFLGPTGVGKTELCKALANFMFDSDEAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQERFGELDYAHMKELVLGVVSHNFRPEFINRIDEV

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
biological_process GO:0009408 - response to heat
GO:0042026 - protein refolding
GO:0034605 - cellular response to heat
GO:0006986 - response to unfolded protein
External database links:  
DIP:
DIP-35844N
ECOCYC:
EG10157-MONOMER
ECOLIWIKI:
b2592
INTERPRO:
IPR003959
INTERPRO:
IPR003593
INTERPRO:
IPR001270
INTERPRO:
IPR004176
INTERPRO:
IPR019489
INTERPRO:
IPR018368
INTERPRO:
IPR017730
INTERPRO:
IPR027417
INTERPRO:
IPR041546
INTERPRO:
IPR036628
INTERPRO:
IPR028299
MINT:
P63284
MODBASE:
P63284
PDB:
6OAX
PDB:
5OG1
PDB:
5OFO
PDB:
4D2X
PDB:
4D2U
PDB:
4D2Q
PDB:
4CIU
PDB:
1KHY
PDB:
1JBK
PDB:
6QS6
PDB:
6QS7
PDB:
6QS8
PDB:
6OG1
PDB:
6OAY
PDB:
6OG3
PDB:
6OG2
PFAM:
PF17871
PFAM:
PF00004
PFAM:
PF07724
PFAM:
PF02861
PFAM:
PF10431
PRIDE:
P63284
PRINTS:
PR00300
PRODB:
PRO_000022297
PROSITE:
PS51903
PROSITE:
PS00870
PROSITE:
PS00871
REFSEQ:
NP_417083
SMART:
SM01086
SMART:
SM00382
SMR:
P63284
UNIPROT:
P63284


Operon      
Name: clpB         
Operon arrangement:
Transcription unit        Promoter
clpB
clpB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2902 2731272 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2903 (cluster) 2733127 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2904 (cluster) 2734197 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2905 2734202 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2907 2734207 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2908 (cluster) 2734293 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Park SK., Kim KI., Woo KM., Seol JH., Tanaka K., Ichihara A., Ha DB., Chung CH., 1993, Site-directed mutagenesis of the dual translational initiation sites of the clpB gene of Escherichia coli and characterization of its gene products., J Biol Chem 268(27):20170-4

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB