RegulonDB RegulonDB 10.9: Gene Form
   

dnaT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaC dnaT yjjB yjjP dnaTp dnaTp TSS_5159 TSS_5159 TSS_5158 TSS_5158 TSS_5157 TSS_5157 yjjAp1 yjjAp1

Gene      
Name: dnaT    Texpresso search in the literature
Synonym(s): ECK4352, EG10244, b4362
Genome position(nucleotides): 4600978 <-- 4601517 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.04
External database links:  
ASAP:
ABE-0014306
CGSC:
839
ECHOBASE:
EB0240
ECOLIHUB:
dnaT
OU-MICROARRAY:
b4362
STRING:
511145.b4362
COLOMBOS: dnaT


Product      
Name: primosomal protein DnaT
Synonym(s): DnaT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 19.455
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
89 -> 155 FAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASN
2 -> 179 SSRVLTPDVVGIDALVHDHQTVLAKAEGGVVAVFANNAPAFYAVTPARLAELLALEEKLARPGSDVALDDQLYQEPQAAPVAVPMGKFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRASNGGLPKRDVNTVSEPDSQIPPGFRG
28 -> 28 E

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:1990158 - DnaB-DnaC-DnaT-PriA-PriB complex
GO:1990077 - primosome complex
molecular_function GO:0003697 - single-stranded DNA binding
GO:0005515 - protein binding
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
biological_process GO:0006260 - DNA replication
GO:0006261 - DNA-dependent DNA replication
GO:0006269 - DNA replication, synthesis of RNA primer
GO:0031297 - replication fork processing
GO:0070207 - protein homotrimerization
External database links:  
DIP:
DIP-47957N
ECOCYC:
EG10244-MONOMER
ECOLIWIKI:
b4362
INTERPRO:
IPR040480
INTERPRO:
IPR020917
MINT:
P0A8J2
PDB:
2RU8
PDB:
4OU6
PDB:
4OU7
PFAM:
PF17948
PRIDE:
P0A8J2
PRODB:
PRO_000022468
REFSEQ:
NP_418782
SMR:
P0A8J2
UNIPROT:
P0A8J2


Operon      
Name: yjjB-dnaTC-yjjA         
Operon arrangement:
Transcription unit        Promoter
dnaTC
dnaTC-yjjA
yjjB-dnaTC
yjjB-dnaTC-yjjA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjjAp1 4600337 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_5157 4601522 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5158 4601548 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5159 4601557 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB