RegulonDB RegulonDB 10.8: Gene Form
   

eno gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrG eno ygcG Cra Cra anti-anti-terminator anti-terminator terminator TSS_3077 TSS_3077 TSS_3076 TSS_3076 enop3 enop3 enop2 enop2 enop1 enop1 TSS_3075 TSS_3075 TSS_3074 (cluster) TSS_3074 (cluster) enop7 enop7 TSS_3073 (cluster) TSS_3073 (cluster) enop6 enop6 TSS_3072 (cluster) TSS_3072 (cluster) enop4 enop4 TSS_3070 TSS_3070 TSS_3069 TSS_3069 TSS_3068 TSS_3068 TSS_3067 TSS_3067 TSS_3066 TSS_3066 TSS_3065 TSS_3065 TSS_3064 (cluster) TSS_3064 (cluster) TSS_3063 TSS_3063 TSS_3062 TSS_3062 TSS_3061 TSS_3061 TSS_3060 TSS_3060 TSS_3059 TSS_3059 TSS_3058 (cluster) TSS_3058 (cluster) TSS_3057 (cluster) TSS_3057 (cluster) TSS_3056 TSS_3056 TSS_3055 TSS_3055

Gene      
Name: eno    Texpresso search in the literature
Synonym(s): ECK2773, EG10258, b2779
Genome position(nucleotides): 2906643 <-- 2907941 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.35
External database links:  
ASAP:
ABE-0009110
CGSC:
823
ECHOBASE:
EB0254
MIM:
612932
OU-MICROARRAY:
b2779
PortEco:
eno
STRING:
511145.b2779
COLOMBOS: eno


Product      
Name: enolase
Synonym(s): Eno
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,extracellular space,cytoskeleton
Molecular weight: 45.655
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
342 -> 342 K
4 -> 134 IVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAKAAAAAKGMPLYEHI
2 -> 432 SKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA
5 -> 34 VKIIGREIIDSRGNPTVEAEVHLEGGFVGM
168 -> 168 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.1 - glycolysis
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0000015 - phosphopyruvate hydratase complex
GO:0005576 - extracellular region
GO:0005856 - cytoskeleton
GO:0009986 - cell surface
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0004634 - phosphopyruvate hydratase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006096 - glycolytic process
External database links:  
DIP:
DIP-31847N
ECOCYC:
ENOLASE-MONOMER
ECOLIWIKI:
b2779
INTERPRO:
IPR020811
INTERPRO:
IPR029017
INTERPRO:
IPR020810
INTERPRO:
IPR020809
INTERPRO:
IPR000941
INTERPRO:
IPR036849
MINT:
MINT-1230935
MODBASE:
P0A6P9
PANTHER:
PTHR11902
PDB:
6BFZ
PDB:
1E9I
PDB:
6BFY
PDB:
5OHG
PDB:
3H8A
PDB:
2FYM
PFAM:
PF00113
PFAM:
PF03952
PRIDE:
P0A6P9
PRINTS:
PR00148
PRODB:
PRO_000022518
PROSITE:
PS00164
REFSEQ:
NP_417259
SMART:
SM01193
SMART:
SM01192
SMR:
P0A6P9
UNIPROT:
P0A6P9


Operon      
Name: pyrG-eno         
Operon arrangement:
Transcription unit        Promoter
eno
eno
eno
eno
eno
eno
pyrG-eno
pyrG-eno
pyrG-eno


Transcriptional Regulation      
Display Regulation             
Repressed by: Cra


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3055 2907117 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3056 2907189 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3057 (cluster) 2907196 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3058 (cluster) 2907241 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3059 2907580 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3060 2907627 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3061 2907633 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3062 2907661 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3063 2907662 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3064 (cluster) 2907665 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3065 2907682 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3066 2907694 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3067 2907716 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3068 2907923 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3069 2907932 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3070 2907956 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3072 (cluster) 2907975 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3073 (cluster) 2908021 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3074 (cluster) 2908226 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3075 2908550 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3076 2908879 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3077 2908881 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB