RegulonDB RegulonDB 10.9: Gene Form
   

fabB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mnmC fabB yfcJ flk FadR FabR anti-anti-terminator anti-terminator terminator fabBp fabBp TSS_2635 TSS_2635 TSS_2634 TSS_2634 TSS_2633 TSS_2633 TSS_2632 TSS_2632 TSS_2631 TSS_2631 TSS_2630 (cluster) TSS_2630 (cluster) yfcJp2 yfcJp2 TSS_2628 TSS_2628

Gene      
Name: fabB    Texpresso search in the literature
Synonym(s): ECK2317, EG10274, b2323, fabC
Genome position(nucleotides): 2440385 <-- 2441605 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.59
External database links:  
ASAP:
ABE-0007675
CGSC:
798
ECHOBASE:
EB0270
ECOLIHUB:
fabB
OU-MICROARRAY:
b2323
STRING:
511145.b2323
COLOMBOS: fabB


Product      
Name: 3-oxoacyl-[acyl carrier protein] synthase 1
Synonym(s): beta;-ketoacyl-ACP synthase I, beta;-ketoacyl-[acyl carrier protein] synthase I, FabB, FabC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.613
Isoelectric point: 5.245
Motif(s):
 
Type Positions Sequence
4 -> 4 A
329 -> 329 A
299 -> 299 G
140 -> 140 S
254 -> 361 YAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0004315 - 3-oxoacyl-[acyl-carrier-protein] synthase activity
GO:0042803 - protein homodimerization activity
biological_process GO:1903966 - monounsaturated fatty acid biosynthetic process
GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0008610 - lipid biosynthetic process
GO:0006633 - fatty acid biosynthetic process
External database links:  
DIP:
DIP-29379N
ECOCYC:
FABB-MONOMER
ECOLIWIKI:
b2323
INTERPRO:
IPR020841
INTERPRO:
IPR000794
INTERPRO:
IPR014030
INTERPRO:
IPR014031
INTERPRO:
IPR016039
INTERPRO:
IPR018201
MODBASE:
P0A953
PANTHER:
PTHR11712
PDB:
2AQ7
PDB:
6OKF
PDB:
6OKC
PDB:
5KOF
PDB:
1DD8
PDB:
1EK4
PDB:
1F91
PDB:
1FJ4
PDB:
1FJ8
PDB:
1G5X
PDB:
1H4F
PDB:
2AQB
PDB:
2BUH
PDB:
2BUI
PDB:
2BYW
PDB:
2BYX
PDB:
2BYY
PDB:
2BYZ
PDB:
2BZ3
PDB:
2BZ4
PDB:
2CDH
PDB:
2CF2
PDB:
2VB7
PDB:
2VB8
PDB:
2VB9
PDB:
2VBA
PFAM:
PF00109
PFAM:
PF02801
PRIDE:
P0A953
PRODB:
PRO_000022560
PROSITE:
PS00606
REFSEQ:
NP_416826
SMART:
SM00825
SMR:
P0A953
UNIPROT:
P0A953


Operon      
Name: fabB         
Operon arrangement:
Transcription unit        Promoter
fabB


Transcriptional Regulation      
Display Regulation             
Activated by: FadR
Repressed by: FabR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2628 2440231 reverse nd [RS-EPT-CBR] [1]
  promoter yfcJp2 2440241 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter TSS_2630 (cluster) 2440572 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2631 2440574 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2632 2440576 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2633 2440845 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2634 2440847 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2635 2441152 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB