RegulonDB RegulonDB 10.9: Gene Form
   

fecE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insI3 fecD fecE yjhV insM fecC terminator anti-terminator anti-anti-terminator terminator fecEp4 fecEp4 fecEp5 fecEp5 fecEp3 fecEp3 insIp5 insIp5 TSS_5123 TSS_5123

Gene      
Name: fecE    Texpresso search in the literature
Synonym(s): ECK4277, EG10290, b4287
Genome position(nucleotides): 4510690 <-- 4511457 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.04
External database links:  
ASAP:
ABE-0014057
CGSC:
35617
ECHOBASE:
EB0286
ECOLIHUB:
fecE
ECOO157CYC:
Z1964
ECOO157CYC:
Z4919
ECOO157CYC:
Z4385
OU-MICROARRAY:
b4287
STRING:
511145.b4287
COLOMBOS: fecE


Product      
Name: ferric citrate ABC transporter ATP binding subunit
Synonym(s): FecE, ferric dicitrate ABC transporter - ATP binding subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 28.191
Isoelectric point: 8.346
Motif(s):
 
Type Positions Sequence
159 -> 166 VVLLDEPT
18 -> 166 LNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPT
139 -> 142 LSGG
35 -> 42 GPNGCGKS
3 -> 238 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVE

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006811 - ion transport
GO:0055072 - iron ion homeostasis
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
FECE-MONOMER
ECOLIWIKI:
b4287
ECOO157CYC:
Z4919-MONOMER
ECOO157CYC:
Z4385-MONOMER
ECOO157CYC:
Z1964-MONOMER
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P15031
PFAM:
PF00005
PRIDE:
P15031
PRODB:
PRO_000022595
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_418707
SMART:
SM00382
SMR:
P15031
UNIPROT:
P15031


Operon      
Name: fecABCDE         
Operon arrangement:
Transcription unit        Promoter
fecABCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PdhR
Repressed by: Fur, HypT
Undetermined regulation AscG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5123 4507785 forward nd [RS-EPT-CBR] [1]
  promoter insIp5 4508686 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter fecEp3 4511530 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter fecEp5 4511639 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter fecEp4 4511644 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB