RegulonDB RegulonDB 10.7: Gene Form
   

fepE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

entF fepE fepG fepC ybdZ fepD

Gene      
Name: fepE    Texpresso search in the literature
Synonym(s): ECK0580, EG10297, b0587
Genome position(nucleotides): 618254 --> 619387 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.97
External database links:  
ASAP:
ABE-0002023
CGSC:
18379
ECHOBASE:
EB0293
OU-MICROARRAY:
b0587
PORTECO:
fepE
REGULONDB:
b0587
STRING:
511145.b0587
M3D: fepE
COLOMBOS: fepE
PortEco: b0587


Product      
Name: polysaccharide co-polymerase family protein FepE
Synonym(s): FepE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 42.1
Isoelectric point: 6.547
Motif(s):
 
Type Positions Sequence
42 -> 62 TVMAVVFAFACAGLLISFILP
339 -> 359 AIIVILSALIGGMVACGGVLL
25 -> 122 NEIDLLNLISVLWRAKKTVMAVVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKSFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLR

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0004713 - protein tyrosine kinase activity
GO:0015620 - ferric-enterobactin transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0018108 - peptidyl-tyrosine phosphorylation
GO:0055072 - iron ion homeostasis
GO:0015685 - ferric-enterobactin import into cell
Note(s): Note(s): ...[more].
Reference(s): [1] Morona R., et al., 2009
External database links:  
DIP:
DIP-9596N
ECOCYC:
EG10297-MONOMER
ECOLIWIKI:
b0587
INTERPRO:
IPR003856
PFAM:
PF02706
PRIDE:
P26266
PRODB:
PRO_000022604
PROTEINMODELPORTAL:
P26266
REFSEQ:
NP_415119
SMR:
P26266
UNIPROT:
P26266


Operon      
Name: fes-ybdZ-entF-fepE         
Operon arrangement:
Transcription unit        Promoter
fes-ybdZ-entF-fepE


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, H-NS
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Morona R., Purins L., Tocilj A., Matte A., Cygler M., 2009, Sequence-structure relationships in polysaccharide co-polymerase (PCP) proteins., Trends Biochem Sci 34(2):78-84


RegulonDB