RegulonDB RegulonDB 10.8: Gene Form
   

ffh gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ffh ypjD rpsP DksA-ppGpp DksA-ppGpp terminator anti-terminator anti-anti-terminator anti-anti-terminator anti-terminator terminator TSS_2961 TSS_2961 TSS_2960 (cluster) TSS_2960 (cluster) TSS_2959 TSS_2959 ypjDp5 ypjDp5 ffhp ffhp ypjDp4 ypjDp4 TSS_2957 TSS_2957 TSS_2956 TSS_2956 TSS_2955 TSS_2955 TSS_2954 TSS_2954 TSS_2953 TSS_2953 rpsPp rpsPp

Gene      
Name: ffh    Texpresso search in the literature
Synonym(s): ECK2607, EG10300, b2610
Genome position(nucleotides): 2746434 <-- 2747795 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.19
External database links:  
ASAP:
ABE-0008586
CGSC:
33006
ECHOBASE:
EB0296
OU-MICROARRAY:
b2610
PortEco:
ffh
STRING:
511145.b2610
COLOMBOS: ffh


Product      
Name: signal recognition particle protein component
Synonym(s): Ffh, P48
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.787
Isoelectric point: 10.262
Motif(s):
 
Type Positions Sequence
248 -> 251 TKVD
329 -> 427 FDLNDFLEQLRQMKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMM
107 -> 114 GLQGAGKT
190 -> 194 DTAGR
100 -> 296 PAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.5 - export, signal peptide cleavage
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.5 - The Type II (General) Secretory Pathway (IISP) Family
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0048500 - signal recognition particle
GO:1990904 - ribonucleoprotein complex
molecular_function GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005525 - GTP binding
GO:0008312 - 7S RNA binding
biological_process GO:0006612 - protein targeting to membrane
GO:0006614 - SRP-dependent cotranslational protein targeting to membrane
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IMP] Inferred from mutant phenotype
Reference(s): [1] Adams H., et al., 2002
[2] Park SK., et al., 2002
[3] Patel S., et al., 1996
[4] Powers T., et al., 1997
[5] Samuelsson T., et al., 1995
[6] Wickstrom D., et al., 2011
External database links:  
DIP:
DIP-31865N
ECOCYC:
EG10300-MONOMER
ECOLIWIKI:
b2610
INTERPRO:
IPR000897
INTERPRO:
IPR022941
INTERPRO:
IPR003593
INTERPRO:
IPR004125
INTERPRO:
IPR013822
INTERPRO:
IPR004780
INTERPRO:
IPR042101
INTERPRO:
IPR036891
INTERPRO:
IPR027417
MINT:
MINT-1218614
MODBASE:
P0AGD7
PANTHER:
PTHR11564:SF7
PANTHER:
PTHR11564
PDB:
3LQX
PDB:
4C7O
PDB:
5AKA
PDB:
5GAF
PDB:
5GAG
PDB:
5GAH
PDB:
5NCO
PDB:
2XXA
PDB:
2XKV
PDB:
2PXV
PDB:
2PXU
PDB:
2PXT
PDB:
2PXQ
PDB:
2PXP
PDB:
2PXL
PDB:
2PXK
PDB:
2PXF
PDB:
2PXE
PDB:
2PXD
PDB:
2PXB
PDB:
2J28
PDB:
1HQ1
PDB:
1DUL
PDB:
5GAD
PFAM:
PF02978
PFAM:
PF02881
PFAM:
PF00448
PRIDE:
P0AGD7
PRODB:
PRO_000022607
PROSITE:
PS00300
REFSEQ:
NP_417101
SMART:
SM00382
SMART:
SM00963
SMART:
SM00962
SMR:
P0AGD7
SWISSMODEL:
P0AGD7
UNIPROT:
P0AGD7


Operon      
Name: ffh         
Operon arrangement:
Transcription unit        Promoter
ffh


Regulation by small RNA    
  Display Regulation
small RNA ffs


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2953 2746288 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_2954 2746292 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_2955 2746316 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_2956 2746694 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_2957 2747250 reverse nd [RS-EPT-CBR] [7]
  promoter ypjDp4 2747846 forward Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter ypjDp5 2747930 forward Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter TSS_2959 2747931 forward nd [RS-EPT-CBR] [7]
  promoter TSS_2960 (cluster) 2748357 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_2961 2748644 forward nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Adams H., Scotti PA., De Cock H., Luirink J., Tommassen J., 2002, The presence of a helix breaker in the hydrophobic core of signal sequences of secretory proteins prevents recognition by the signal-recognition particle in Escherichia coli., Eur J Biochem 269(22):5564-71

 [2] Park SK., Jiang F., Dalbey RE., Phillips GJ., 2002, Functional analysis of the signal recognition particle in Escherichia coli by characterization of a temperature-sensitive ffh mutant., J Bacteriol 184(10):2642-53

 [3] Patel S., Austen BM., 1996, Substitution of fifty four homologue (Ffh) in Escherichia coli with the mammalian 54-kDa protein of signal-recognition particle., Eur J Biochem 238(3):760-8

 [4] Powers T., Walter P., 1997, Co-translational protein targeting catalyzed by the Escherichia coli signal recognition particle and its receptor., EMBO J 16(16):4880-6

 [5] Samuelsson T., Olsson M., Wikstrom PM., Johansson BR., 1995, The GTPase activity of the Escherichia coli Ffh protein is important for normal growth., Biochim Biophys Acta 1267(2-3):83-91

 [6] Wickstrom D., Wagner S., Baars L., Ytterberg AJ., Klepsch M., van Wijk KJ., Luirink J., de Gier JW., 2011, Consequences of depletion of the signal recognition particle in Escherichia coli., J Biol Chem 286(6):4598-609

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [8] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB