RegulonDB RegulonDB 10.9: Gene Form
   

fimA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fimE fimA fimI Lrp Lrp Lrp IHF IHF TSS_5136 TSS_5136 TSS_5135 TSS_5135 TSS_5134 TSS_5134 TSS_5133 (cluster) TSS_5133 (cluster) TSS_5132 TSS_5132 fimAp fimAp

Gene      
Name: fimA    Texpresso search in the literature
Synonym(s): ECK4305, EG10308, b4314, fimD, pilA
Genome position(nucleotides): 4543115 --> 4543663 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.73
External database links:  
ASAP:
ABE-0014145
CGSC:
18358
ECHOBASE:
EB0304
ECOLIHUB:
fimA
OU-MICROARRAY:
b4314
STRING:
511145.b4314
COLOMBOS: fimA


Product      
Name: type 1 fimbriae major subunit
Synonym(s): FimA, FimD, PilA
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 18.111
Isoelectric point: 4.952
Motif(s):
 
Type Positions Sequence
20 -> 20 A
34 -> 182 HFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
1 -> 23 MKIKTLAIVVLSALSLSSTAALA
24 -> 182 AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
163 -> 163 T

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
molecular_function GO:0042802 - identical protein binding
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Reference(s): [1] Puorger C., et al., 2011
[2] Walczak MJ., et al., 2014
[3] Zyla DS., et al., 2019
External database links:  
DIP:
DIP-9609N
ECOCYC:
EG10308-MONOMER
ECOLIWIKI:
b4314
INTERPRO:
IPR036937
INTERPRO:
IPR000259
INTERPRO:
IPR008966
MODBASE:
P04128
PDB:
6C53
PDB:
6R74
PDB:
2JTY
PDB:
2M5G
PDB:
2N7H
PDB:
3SQB
PDB:
4DWH
PDB:
5NKT
PDB:
5OH0
PFAM:
PF00419
PRIDE:
P04128
PRODB:
PRO_000022616
REFSEQ:
NP_418734
SMR:
P04128
UNIPROT:
P04128


Operon      
Name: fimAICDFGH         
Operon arrangement:
Transcription unit        Promoter
fimAICDFGH


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, IHF, Lrp, QseB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5132 4542983 forward nd [RS-EPT-CBR] [4]
  promoter TSS_5133 (cluster) 4543095 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_5134 4543103 forward nd [RS-EPT-CBR] [4]
  promoter TSS_5135 4543121 forward nd [RS-EPT-CBR] [4]
  promoter TSS_5136 4543128 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Puorger C., Vetsch M., Wider G., Glockshuber R., 2011, Structure, folding and stability of FimA, the main structural subunit of type 1 pili from uropathogenic Escherichia coli strains., J Mol Biol 412(3):520-35

 [2] Walczak MJ., Puorger C., Glockshuber R., Wider G., 2014, Intramolecular donor strand complementation in the E. coli type 1 pilus subunit FimA explains the existence of FimA monomers as off-pathway products of pilus assembly that inhibit host cell apoptosis., J Mol Biol 426(3):542-9

 [3] Zyla DS., Prota AE., Capitani G., Glockshuber R., 2019, Alternative folding to a monomer or homopolymer is a common feature of the type 1 pilus subunit FimA from enteroinvasive bacteria., J Biol Chem 294(27):10553-10563

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB