RegulonDB RegulonDB 10.9: Gene Form
   

frdB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

frdA epmA frdB frdC DcuR FNR NarL NarL NarL NarL NarL anti-terminator anti-anti-terminator TSS_4998 TSS_4998 epmAp epmAp TSS_4996 (cluster) TSS_4996 (cluster) frdAp frdAp TSS_4995 (cluster) TSS_4995 (cluster) TSS_4994 TSS_4994 TSS_4993 (cluster) TSS_4993 (cluster) TSS_4992 TSS_4992 TSS_4991 (cluster) TSS_4991 (cluster) TSS_4990 (cluster) TSS_4990 (cluster) TSS_4989 TSS_4989 TSS_4988 TSS_4988 TSS_4987 TSS_4987 TSS_4986 TSS_4986 TSS_4985 TSS_4985 TSS_4984 TSS_4984 TSS_4983 TSS_4983 TSS_4982 TSS_4982 TSS_4981 TSS_4981 TSS_4980 (cluster) TSS_4980 (cluster) TSS_4979 TSS_4979 TSS_4978 TSS_4978 TSS_4977 TSS_4977 TSS_4976 TSS_4976 TSS_4975 (cluster) TSS_4975 (cluster) TSS_4974 TSS_4974 TSS_4973 TSS_4973 TSS_4972 TSS_4972 frdDp7 frdDp7 frdDp1 frdDp1 TSS_4971 TSS_4971 frdDp2 frdDp2

Gene      
Name: frdB    Texpresso search in the literature
Synonym(s): ECK4149, EG10331, b4153
Genome position(nucleotides): 4379783 <-- 4380517 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.61
External database links:  
ASAP:
ABE-0013602
CGSC:
741
ECHOBASE:
EB0327
ECOLIHUB:
frdB
OU-MICROARRAY:
b4153
STRING:
511145.b4153
COLOMBOS: frdB


Product      
Name: fumarate reductase iron-sulfur protein
Synonym(s): FrdB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 27.123
Isoelectric point: 6.491
Motif(s):
 
Type Positions Sequence
2 -> 244 AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
63 -> 63 C
66 -> 66 C
146 -> 219 FSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHV
58 -> 58 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0045284 - plasma membrane fumarate reductase complex
molecular_function GO:0102040 - fumarate reductase (menaquinone)
GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0051538 - 3 iron, 4 sulfur cluster binding
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0006113 - fermentation
GO:0009061 - anaerobic respiration
GO:0001539 - cilium or flagellum-dependent cell motility
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0044780 - bacterial-type flagellum assembly
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9682N
ECOCYC:
FUM-FE-S
ECOLIWIKI:
b4153
INTERPRO:
IPR009051
INTERPRO:
IPR017900
INTERPRO:
IPR001041
INTERPRO:
IPR004489
INTERPRO:
IPR006058
INTERPRO:
IPR025192
INTERPRO:
IPR012675
INTERPRO:
IPR017896
INTERPRO:
IPR036010
PDB:
3P4R
PDB:
3P4S
PDB:
3CIR
PDB:
3P4P
PDB:
2B76
PDB:
3P4Q
PDB:
1KF6
PDB:
1KFY
PDB:
1L0V
PFAM:
PF13183
PFAM:
PF13085
PRIDE:
P0AC47
PRODB:
PRO_000022687
PROSITE:
PS51379
PROSITE:
PS51085
PROSITE:
PS00198
PROSITE:
PS00197
REFSEQ:
NP_418577
SMR:
P0AC47
UNIPROT:
P0AC47


Operon      
Name: frdABCD         
Operon arrangement:
Transcription unit        Promoter
frdABCD
frdABCD


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, DcuR
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter frdDp2 4379433 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4971 4379467 reverse nd [RS-EPT-CBR] [2]
  promoter frdDp1 4379473 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter frdDp7 4379474 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4972 4379642 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4973 4380402 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4974 4380562 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4975 (cluster) 4380608 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4976 4380764 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4977 4380768 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4978 4380783 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4979 4380790 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4980 (cluster) 4380795 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4981 4380800 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4982 4380895 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4983 4381317 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4984 4381338 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4985 4381346 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4986 4381467 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4987 4381476 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4988 4381624 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4989 4382039 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4990 (cluster) 4382309 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4991 (cluster) 4382324 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4992 4382327 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4993 (cluster) 4382334 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4994 4382336 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4995 (cluster) 4382398 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4996 (cluster) 4382418 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4998 4383369 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB