RegulonDB RegulonDB 10.10: Gene Form
   

ftsE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftsY ftsX rpoH ftsE IHF CRP DnaA CytR CytR DnaA CRP CRP TSS_4071 TSS_4071 TSS_4070 TSS_4070 TSS_4069 TSS_4069 ftsXp4 ftsXp4 ftsXp3 ftsXp3 rpoHp1 rpoHp1 rpoHp3 rpoHp3 TSS_4067 TSS_4067 TSS_4066 TSS_4066 rpoHp4 rpoHp4 rpoHp5 rpoHp5 rpoHp6 rpoHp6

Gene      
Name: ftsE    Texpresso search in the literature
Synonym(s): ECK3447, EG10340, b3463
Genome position(nucleotides): 3602079 <-- 3602747 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.35
External database links:  
ASAP:
ABE-0011313
CGSC:
736
ECHOBASE:
EB0336
ECOLIHUB:
ftsE
OU-MICROARRAY:
b3463
STRING:
511145.b3463
COLOMBOS: ftsE


Product      
Name: cell division protein FtsE
Synonym(s): FtsE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 24.439
Isoelectric point: 9.867
Motif(s):
 
Type Positions Sequence
35 -> 42 GHSGAGKS
2 -> 222 IRFEHVSKAYLGGRQALQGVTFHMQPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIWFSGHDITRLKNREVPFLRRQIGMIFQDHHLLMDRTVYDNVAIPLIIAGASGDDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRVGVTVLMATHDINLISRRSYRMLTLSDGHLHGGVGHE
41 -> 41 K
18 -> 165 LQGVTFHMQPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIWFSGHDITRLKNREVPFLRRQIGMIFQDHHLLMDRTVYDNVAIPLIIAGASGDDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPT
49 -> 49 C

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0019898 - extrinsic component of membrane
GO:0031234 - extrinsic component of cytoplasmic side of plasma membrane
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0016887 - ATP hydrolysis activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0022857 - transmembrane transporter activity
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0046677 - response to antibiotic
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Mallick S., et al., 2020
External database links:  
DIP:
DIP-47843N
ECOCYC:
FTSE-MONOMER
ECOLIWIKI:
b3463
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR005286
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P0A9R7
PFAM:
PF00005
PRIDE:
P0A9R7
PRODB:
PRO_000022716
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_417920
SMART:
SM00382
SMR:
P0A9R7
UNIPROT:
P0A9R7


Operon      
Name: ftsYEX         
Operon arrangement:
Transcription unit        Promoter
ftsYEX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4066 3600865 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4067 3600867 reverse nd [RS-EPT-CBR] [2]
  promoter ftsXp3 3602252 reverse nd [ICWHO] [3]
  promoter ftsXp4 3602256 reverse nd [ICWHO] [3]
  promoter TSS_4069 3602342 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4070 3604151 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4071 3604210 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Mallick S., Kumar A., Dodia H., Alexander C., Vasudevan D., Beuria TK., 2020, Biochemical characterization of an E. coli cell division factor FtsE shows ATPase cycles similar to the NBDs of ABC-transporters., Biosci Rep

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB