RegulonDB RegulonDB 11.0: Gene Form
   

ftsX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftsY ftsX rpoH ftsE IHF CRP DnaA CytR CytR DnaA CRP CRP TSS_4071 TSS_4071 TSS_4070 TSS_4070 TSS_4069 TSS_4069 ftsXp4 ftsXp4 ftsXp3 ftsXp3 rpoHp2 rpoHp2 rpoHp1 rpoHp1 rpoHp3 rpoHp3 TSS_4067 TSS_4067 TSS_4066 TSS_4066 rpoHp4 rpoHp4 rpoHp5 rpoHp5 rpoHp6 rpoHp6

Gene      
Name: ftsX    Texpresso search in the literature
Synonym(s): ECK3446, EG10345, b3462, ftsS
Genome position(nucleotides): 3601028 <-- 3602086
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.07
External database links:  
ASAP:
ABE-0011311
CGSC:
18298
ECHOBASE:
EB0341
ECOLIHUB:
ftsX
OU-MICROARRAY:
b3462
STRING:
511145.b3462
COLOMBOS: ftsX


Product      
Name: cell division protein FtsX
Synonym(s): FtsS, FtsX
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cell wall
Molecular weight: 38.544
Isoelectric point: 9.311
Motif(s):
 
Type Positions Sequence Comment
19 -> 48 RFRKSVGGSGDGGRNAPKRAKSSPKPVNRK UniProt: Disordered; Sequence Annotation Type: region of interest.
75 -> 95 FLTVMVIAISLTLPSVCYMVY UniProt: Helical.
110 -> 204 QITVYLQKTLDDDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKLDFQGTESLNTLRDRITQINGIDEV
224 -> 244 VSAMIGVLMVAAVFLVIGNSV UniProt: Helical.
227 -> 340 MIGVLMVAAVFLVIGNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSSAVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0000935 - division septum
GO:1990586 - divisome complex
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0009276 - Gram-negative-bacterium-type cell wall
GO:0032153 - cell division site
GO:0098797 - plasma membrane protein complex
GO:1904949 - ATPase complex
molecular_function GO:0005515 - protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0009254 - peptidoglycan turnover
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0051781 - positive regulation of cell division
Note(s): Note(s): ...[more].
Reference(s): [1] Gibbs TW., et al., 1992
[2] Gill DR., et al., 1986
[3] Gill DR., et al., 1987
[4] Salmond GP., et al., 1984
[5] de Leeuw E., et al., 1999
External database links:  
ALPHAFOLD:
P0AC30
DIP:
DIP-35993N
ECOCYC:
FTSX-MONOMER
ECOLIWIKI:
b3462
INTERPRO:
IPR004513
INTERPRO:
IPR040690
INTERPRO:
IPR003838
PANTHER:
PTHR47755
PDB:
6TPI
PFAM:
PF02687
PFAM:
PF18075
PRIDE:
P0AC30
PRODB:
PRO_000022724
REFSEQ:
NP_417919
SMR:
P0AC30
UNIPROT:
P0AC30


Operon      
Name: ftsYEX         
Operon arrangement:
Transcription unit        Promoter
ftsYEX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4066 3600865 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_4067 3600867 reverse nd [RS-EPT-CBR] [6]
  promoter ftsXp3 3602252 reverse nd [ICWHO] [7]
  promoter ftsXp4 3602256 reverse nd [ICWHO] [7]
  promoter TSS_4069 3602342 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_4070 3604151 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_4071 3604210 reverse nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gibbs TW., Gill DR., Salmond GP., 1992, Localised mutagenesis of the fts YEX operon: conditionally lethal missense substitutions in the FtsE cell division protein of Escherichia coli are similar to those found in the cystic fibrosis transmembrane conductance regulator protein (CFTR) of human patients., Mol Gen Genet 234(1):121-8

 [2] Gill DR., Hatfull GF., Salmond GP., 1986, A new cell division operon in Escherichia coli., Mol Gen Genet 205(1):134-45

 [3] Gill DR., Salmond GP., 1987, The Escherichia coli cell division proteins FtsY, FtsE and FtsX are inner membrane-associated., Mol Gen Genet 210(3):504-8

 [4] Salmond GP., Plakidou S., 1984, Genetic analysis of essential genes in the ftsE region of the Escherichia coli genetic map and identification of a new cell division gene, ftsS., Mol Gen Genet 197(2):304-8

 [5] de Leeuw E., Graham B., Phillips GJ., ten Hagen-Jongman CM., Oudega B., Luirink J., 1999, Molecular characterization of Escherichia coli FtsE and FtsX., Mol Microbiol 31(3):983-93

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB