RegulonDB RegulonDB 10.7: Gene Form
   

mokC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insL-1 unknown mokC hokC sokC terminator TSS_41 TSS_41 hokCp4 hokCp4 TSS_40 TSS_40 TSS_39 TSS_39

Gene      
Name: mokC    Texpresso search in the literature
Synonym(s): ECK0018, EG10373, b0018, gefL
Genome position(nucleotides): 16751 <-- 16960 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.43
External database links:  
ASAP:
ABE-0000064
ECHOBASE:
EB1999
OU-MICROARRAY:
b0018
PORTECO:
mokC
REGULONDB:
b0018
STRING:
511145.b0018
M3D: mokC
COLOMBOS: mokC
PortEco: b0018


Product      
Name: regulatory protein MokC
Synonym(s): GefL, MokC, regulatory peptide whose translation enables hokC (gef) expression
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.742
Isoelectric point: 9.443
Motif(s):
 
Type Positions Sequence
25 -> 66 AMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAY
24 -> 44 KAMIVALIVICITAVVAALVT

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Pedersen K., et al., 1999
External database links:  
ECOCYC:
EG10373-MONOMER
ECOLIWIKI:
b0018
INTERPRO:
IPR000021
INTERPRO:
IPR018084
PFAM:
PF01848
PRIDE:
P33236
PRINTS:
PR00281
PRODOM:
PD005979
PROSITE:
PS00556
PROTEINMODELPORTAL:
P33236
REFSEQ:
NP_414559
UNIPROT:
P33236


Operon      
Name: mokC-hokC         
Operon arrangement:
Transcription unit        Promoter
 


Regulation by small RNA    
  Display Regulation
small RNA sokC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_39 15463 forward nd [RS-EPT-CBR] [2]
  promoter TSS_40 15553 forward nd [RS-EPT-CBR] [2]
  promoter hokCp4 16951 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_41 16961 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_42 18023 forward nd [RS-EPT-CBR] [2]
  promoter TSS_43 18025 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Pedersen K., Gerdes K., 1999, Multiple hok genes on the chromosome of Escherichia coli., Mol Microbiol 32(5):1090-102

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB