RegulonDB RegulonDB 10.8: Gene Form
   

hisB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: hisB    Texpresso search in the literature
Synonym(s): ECK2017, EG10445, b2022
Genome position(nucleotides): 2093468 --> 2094535 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.37
External database links:  
ASAP:
ABE-0006720
CGSC:
635
ECHOBASE:
EB0440
MIM:
613402
MIM:
616267
OU-MICROARRAY:
b2022
PortEco:
hisB
STRING:
511145.b2022
COLOMBOS: hisB


Product      
Name: imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase
Synonym(s): HisB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.278
Isoelectric point: 6.097
Motif(s):
 
Type Positions Sequence
196 -> 337 TGVGFFDHMLDQIATHGGFRMEINVKGDLYIDDHHTVEDTGLALGEALKIALGDKRGICRFGFVLPMDECLARCALDISGRPHLEYKAEFTYQRVGDLSTEMIEHFFRSLSYTMGVTLHLKTKGKNDHHRVESLFKAFGRTL
1 -> 166 MSQKYLFIDRDGTLISEPPSDFQVDRFDKLAFEPGVIPELLKLQKAGYKLVMITNQDGLGTQSFPQADFDGPHNLMMQIFTSQGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQAMDRANSYVIGDRATDIQLAENMGITGLRYDRETLNWPMIGEQLTRRD
167 -> 355 RYAHVVRNTKETQIDVQVWLDREGGSKINTGVGFFDHMLDQIATHGGFRMEINVKGDLYIDDHHTVEDTGLALGEALKIALGDKRGICRFGFVLPMDECLARCALDISGRPHLEYKAEFTYQRVGDLSTEMIEHFFRSLSYTMGVTLHLKTKGKNDHHRVESLFKAFGRTLRQAIRVEGDTLPSSKGVL
8 -> 134 IDRDGTLISEPPSDFQVDRFDKLAFEPGVIPELLKLQKAGYKLVMITNQDGLGTQSFPQADFDGPHNLMMQIFTSQGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQAMDRANSYVIGDRATD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.16 - histidine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0004401 - histidinol-phosphatase activity
GO:0004424 - imidazoleglycerol-phosphate dehydratase activity
GO:0016791 - phosphatase activity
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0000105 - histidine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0016311 - dephosphorylation
External database links:  
DIP:
DIP-9901N
ECOCYC:
IMIDPHOSPHADEHYDHISTIDPHOSPHA-MONOMER
ECOLIWIKI:
b2022
INTERPRO:
IPR005954
INTERPRO:
IPR038494
INTERPRO:
IPR036412
INTERPRO:
IPR023214
INTERPRO:
IPR020568
INTERPRO:
IPR020566
INTERPRO:
IPR020565
INTERPRO:
IPR013954
INTERPRO:
IPR006549
INTERPRO:
IPR000807
INTERPRO:
IPR006543
MODBASE:
P06987
PANTHER:
PTHR23133
PDB:
2FPX
PDB:
2FPS
PDB:
2FPR
PDB:
2FPW
PDB:
2FPU
PFAM:
PF00475
PFAM:
PF08645
PRIDE:
P06987
PRODB:
PRO_000022892
PROSITE:
PS00954
PROSITE:
PS00955
REFSEQ:
NP_416526
SMR:
P06987
UNIPROT:
P06987


Operon      
Name: hisLGDCBHAFI         
Operon arrangement:
Transcription unit        Promoter
hisL
hisLGDCBHAFI
hisBHAFI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2344 2091101 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2345 2091377 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2346 (cluster) 2091387 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2347 2091423 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2348 2092208 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2349 2092215 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2350 2092396 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2351 (cluster) 2093335 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2352 2093364 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2353 2093383 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2354 2093403 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2355 2093486 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2356 2094307 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2357 2094355 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2358 2095145 forward nd [RS-EPT-CBR] [1]



RegulonDB