RegulonDB RegulonDB 11.0: Gene Form
   

hycA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hycB hycA hypA hycC FNR FNR ModE FhlA FhlA NsrR IHF FhlA FhlA anti-anti-terminator anti-terminator terminator hypBp hypBp hypAp hypAp hycAp hycAp

Gene      
Name: hycA    Texpresso search in the literature
Synonym(s): ECK2720, EG10474, b2725, hevA
Genome position(nucleotides): 2849974 <-- 2850435
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.22
External database links:  
ASAP:
ABE-0008952
CGSC:
33143
ECHOBASE:
EB0469
ECOLIHUB:
hycA
OU-MICROARRAY:
b2725
STRING:
511145.b2725
COLOMBOS: hycA


Product      
Name: regulator of the transcriptional regulator FhlA
Synonym(s): HevA, HycA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.627
Isoelectric point: 6.148
Motif(s):
 
Type Positions Sequence Comment
1 -> 146 MTIWEISEKADYIAQRHRRLQDQWHIYCNSLVQGITLSKARLHHAMSCAPDKELCFVLFEHFRIYVTLADGFNSHTIEYYVETKDGEDKQRIAQAQLSIDGMIDGKVNIRDREQVLEHYLEKIAGVYDSLYTAIENNVPVNLSQLV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Perez-Rueda E., et al., 2004
[2] Sauter M., et al., 1992
External database links:  
ALPHAFOLD:
P0AEV4
ECOCYC:
EG10474-MONOMER
ECOLIWIKI:
b2725
INTERPRO:
IPR021285
PFAM:
PF11046
PRIDE:
P0AEV4
PRODB:
PRO_000022954
REFSEQ:
NP_417205
UNIPROT:
P0AEV4


Operon      
Name: hycABCDEFGHI         
Operon arrangement:
Transcription unit        Promoter
hycABCDEFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, IHF, ModE
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [2] Sauter M., Bohm R., Bock A., 1992, Mutational analysis of the operon (hyc) determining hydrogenase 3 formation in Escherichia coli., Mol Microbiol 6(11):1523-32


RegulonDB