RegulonDB RegulonDB 10.8: Gene Form
   

hycB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: hycB    Texpresso search in the literature
Synonym(s): ECK2719, EG10475, b2724, hevB
Genome position(nucleotides): 2849238 <-- 2849849 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.35
External database links:  
ASAP:
ABE-0008950
CGSC:
33169
ECHOBASE:
EB0470
OU-MICROARRAY:
b2724
PortEco:
hycB
STRING:
511145.b2724
COLOMBOS: hycB


Product      
Name: formate hydrogenlyase subunit HycB
Synonym(s): HevB, HycB, formate hydrogenlyase complex, iron-sulfur protein HycB, hydrogenase 3, Fe-S subunit HycB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.873
Isoelectric point: 6.985
Motif(s):
 
Type Positions Sequence
2 -> 32 NRFVIADSTLCIGCHTCEAACSETHRQHGLQ
73 -> 102 GAVQLNESLCVSCKLCGIACPFGAIEFSGS
156 -> 156 V
47 -> 97 APQLCHHCEDAPCAVVCPVNAITRVDGAVQLNESLCVSCKLCGIACPFGAI
42 -> 72 NEKESAPQLCHHCEDAPCAVVCPVNAITRVD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0017113 - dihydropyrimidine dehydrogenase (NADP+) activity
GO:0002058 - uracil binding
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0050661 - NADP binding
biological_process GO:0055114 - oxidation-reduction process
GO:0006212 - uracil catabolic process
GO:0006210 - thymine catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Pinske C. 2018
External database links:  
ECOCYC:
HYCBSMALL-MONOMER
ECOLIWIKI:
b2724
INTERPRO:
IPR017900
INTERPRO:
IPR017896
MINT:
P0AAK1
MODBASE:
P0AAK1
PFAM:
PF13247
PRIDE:
P0AAK1
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
NP_417204
SMR:
P0AAK1
UNIPROT:
P0AAK1


Operon      
Name: hycABCDEFGHI         
Operon arrangement:
Transcription unit        Promoter
hycABCDEFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, IHF, ModE
Repressed by: NsrR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB