RegulonDB RegulonDB 10.8: Gene Form
   

hycD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: hycD    Texpresso search in the literature
Synonym(s): ECK2717, EG10477, b2722, hevD
Genome position(nucleotides): 2846489 <-- 2847412 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.44
Note(s): ArcA appears to activate hycD gene expression under anaerobiosis. A putative ArcA binding site was identified 55 bp upstream of this gene Salmon KA,2005, but no promoter upstream of it has been identified. Instead hycD is transcribed from a promoter that is located usptream of hycA gene.
External database links:  
ASAP:
ABE-0008946
CGSC:
33162
ECHOBASE:
EB0472
OU-MICROARRAY:
b2722
PortEco:
hycD
STRING:
511145.b2722
COLOMBOS: hycD


Product      
Name: formate hydrogenlyase subunit HycD
Synonym(s): Ant-3, Ant-5, HevD, HycD, formate hydrogenlyase complex, membrane subunit HycD, hydrogenase 3 membrane subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.029
Isoelectric point: 7.41
Motif(s):
 
Type Positions Sequence
3 -> 23 VLYPLIQALVLFAVAPLLSGI
9 -> 302 QALVLFAVAPLLSGITRVARARLHNRRGPGVLQEYRDIIKLLGRQSVGPDASGWVFRLTPYVMVGVMLTIATALPVVTVGSPLPQLGDLITLLYLFAIARFFFAISGLDTGSPFTAIGASREAMLGVLVEPMLLLGLWVAAQVAGSTNISNITDTVYHWPLSQSIPLVLALCACAFATFIEMGKLPFDLAEAEQELQEGPLSEYSGSGFGVMKWGISLKQLVVLQMFVGVFIPWGQMETFTAGGLLLALVIAIVKLVVGVLVIALFENSMARLRLDITPRITWAGFGFAFLAFV
68 -> 88 PYVMVGVMLTIATALPVVTVG
168 -> 188 PLSQSIPLVLALCACAFATFI
254 -> 274 LLALVIAIVKLVVGVLVIALF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016491 - oxidoreductase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
HYCD-MONOMER
ECOLIWIKI:
b2722
INTERPRO:
IPR018086
INTERPRO:
IPR001694
PANTHER:
PTHR11432
PFAM:
PF00146
PRIDE:
P16430
PRODB:
PRO_000022956
PROSITE:
PS00667
PROSITE:
PS00668
REFSEQ:
NP_417202
SMR:
P16430
UNIPROT:
P16430


Operon      
Name: hycABCDEFGHI         
Operon arrangement:
Transcription unit        Promoter
hycABCDEFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, IHF, ModE
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB