RegulonDB RegulonDB 10.8: Gene Form
   

hycE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hycE hycD hycF

Gene      
Name: hycE    Texpresso search in the literature
Synonym(s): ECK2716, EG10478, b2721, hevE
Genome position(nucleotides): 2844762 <-- 2846471 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.9
External database links:  
ASAP:
ABE-0008944
CGSC:
33159
ECHOBASE:
EB0473
OU-MICROARRAY:
b2721
PortEco:
hycE
STRING:
511145.b2721
COLOMBOS: hycE


Product      
Name: formate hydrogenlyase subunit HycE
Synonym(s): Ant-1, HevE, HycE, formate hydrogenlyase complex, hydrogenase 3 subunit HycE, hydrogenase 3 large subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 64.98
Isoelectric point: 6.576
Motif(s):
 
Type Positions Sequence
538 -> 569 MTVVDVRKKKSKVVPYKELERYSIERKNSPLK
1 -> 537 MSEEKLGQHYLAALNEAFPGVVLDHAWQTKDQLTVTVKVNYLPEVVEFLYYKQGGWLSVLFGNDERKLNGHYAVYYVLSMEKGTKCWITVRVEVDANKPEYPSVTPRVPAAVWGEREVRDMYGLIPVGLPDERRLVLPDDWPDELYPLRKDSMDYRQRPAPTTDAETYEFINELGDKKNNVVPIGPLHVTSDEPGHFRLFVDGENIIDADYRLFYVHRGMEKLAETRMGYNEVTFLSDRVCGICGFAHSTAYTTSVENAMGIQVPERAQMIRAILLEVERLHSHLLNLGLACHFTGFDSGFMQFFRVRETSMKMAEILTGARKTYGLNLIGGIRRDLLKDDMIQTRQLAQQMRREVQELVDVLLSTPNMEQRTVGIGRLDPEIARDFSNVGPMVRASGHARDTRADHPFVGYGLLPMEVHSEQGCDVISRLKVRINEVYTALNMIDYGLDNLPGGPLMVEGFTYIPHRFALGFAEAPRGDDIHWSMTGDNQKLYRWRCRAATYANWPTLRYMLRGNTVSDAPLIIGSLDPCYSCTDR
296 -> 464 GFDSGFMQFFRVRETSMKMAEILTGARKTYGLNLIGGIRRDLLKDDMIQTRQLAQQMRREVQELVDVLLSTPNMEQRTVGIGRLDPEIARDFSNVGPMVRASGHARDTRADHPFVGYGLLPMEVHSEQGCDVISRLKVRINEVYTALNMIDYGLDNLPGGPLMVEGFTY
36 -> 152 TVKVNYLPEVVEFLYYKQGGWLSVLFGNDERKLNGHYAVYYVLSMEKGTKCWITVRVEVDANKPEYPSVTPRVPAAVWGEREVRDMYGLIPVGLPDERRLVLPDDWPDELYPLRKDS
218 -> 286 RGMEKLAETRMGYNEVTFLSDRVCGICGFAHSTAYTTSVENAMGIQVPERAQMIRAILLEVERLHSHLL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0016151 - nickel cation binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008137 - NADH dehydrogenase (ubiquinone) activity
GO:0048038 - quinone binding
GO:0051287 - NAD binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Skorupa P., et al., 2020
External database links:  
DIP:
DIP-9975N
ECOCYC:
HYCELARGE-MONOMER
ECOLIWIKI:
b2721
INTERPRO:
IPR037232
INTERPRO:
IPR038290
INTERPRO:
IPR029014
INTERPRO:
IPR014029
INTERPRO:
IPR001501
INTERPRO:
IPR001268
INTERPRO:
IPR001135
MINT:
P16431
MODBASE:
P16431
PFAM:
PF00374
PFAM:
PF00329
PFAM:
PF00346
PRIDE:
P16431
PRODB:
PRO_000022957
PRODOM:
PD001581
PROSITE:
PS00535
REFSEQ:
NP_417201
SMR:
P16431
UNIPROT:
P16431


Operon      
Name: hycABCDEFGHI         
Operon arrangement:
Transcription unit        Promoter
hycABCDEFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, IHF, ModE
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Skorupa P., Lindenstrauss U., Burschel S., Blumenscheit C., Friedrich T., Pinske C., 2020, The N-terminal domains of the paralogous HycE and NuoCD govern assembly of the respective formate hydrogenlyase and NADH dehydrogenase complexes., FEBS Open Bio


RegulonDB