RegulonDB RegulonDB 10.8: Gene Form
   

hypE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhlA hypD hypE hypC hypB OxyS OxyS terminator

Gene      
Name: hypE    Texpresso search in the literature
Synonym(s): ECK2725, EG10487, b2730, hydB
Genome position(nucleotides): 2853254 --> 2854264 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.27
External database links:  
ASAP:
ABE-0008967
CGSC:
33119
ECHOBASE:
EB0482
OU-MICROARRAY:
b2730
PortEco:
hypE
STRING:
511145.b2730
COLOMBOS: hypE


Shine dalgarno      
Sequence: ccacggtagcGGCGGCcaggcgATG


Product      
Name: hydrogenase maturation protein, carbamoyl dehydratase
Synonym(s): HydB, HypE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.092
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
53 -> 152 LAFSTDSYVIDPLFFPGGNIGKLAICGTANDVAVSGAIPRYLSCGFILEEGLPMETLKAVVTSMAETARAAGIAIVTGDTKVVQRGAVDKLFINTAGMGA
166 -> 313 AGDVLLVSGTLGDHGATILNLREQLGLDGELVSDCAVLTPLIQTLRDIPGVKALRDATRGGVNAVVHEFAAACGCGIELSEAALPVKPAVRGVCELLGLDALNFANEGKLVIAVERNAAEQVLAALHSHPLGKDAALIGEVVERKGVR
83 -> 83 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
biological_process GO:0051604 - protein maturation
GO:0046892 - peptidyl-S-carbamoyl-L-cysteine dehydration
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Chaudhuri A., et al., 1987
[2] Lee JH., et al., 1985
[3] McKinlay JB., et al., 2004
[4] Reissmann S., et al., 2003
[5] Sankar P., et al., 1985
[6] Sankar P., et al., 1988
[7] Soboh B., et al., 2014
[8] Yamamoto T., et al., 1990
External database links:  
DIP:
DIP-9999N
ECOCYC:
EG10487-MONOMER
ECOLIWIKI:
B2730
INTERPRO:
IPR011854
INTERPRO:
IPR036921
INTERPRO:
IPR036676
INTERPRO:
IPR016188
INTERPRO:
IPR010918
MINT:
MINT-1239514
MODBASE:
P24193
PANTHER:
PTHR30303
PDB:
2I6R
PFAM:
PF02769
PFAM:
PF00586
PRIDE:
P24193
PRODB:
PRO_000022976
REFSEQ:
NP_417210
SMR:
P24193
UNIPROT:
P24193


Operon      
Name: hypABCDE-fhlA         
Operon arrangement:
Transcription unit        Promoter
hypABCDE
hypABCDE-fhlA
hypBCDE
hypBCDE-fhlA


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, FNR, IHF
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Chaudhuri A., Krasna AI., 1987, Isolation of genes required for hydrogenase synthesis in Escherichia coli., J Gen Microbiol 133(12):3289-98

 [2] Lee JH., Patel P., Sankar P., Shanmugam KT., 1985, Isolation and characterization of mutant strains of Escherichia coli altered in H2 metabolism., J Bacteriol 162(1):344-52

 [3] McKinlay JB., Zeikus JG., 2004, Extracellular iron reduction is mediated in part by neutral red and hydrogenase in Escherichia coli., Appl Environ Microbiol 70(6):3467-74

 [4] Reissmann S., Hochleitner E., Wang H., Paschos A., Lottspeich F., Glass RS., Bock A., 2003, Taming of a poison: biosynthesis of the NiFe-hydrogenase cyanide ligands., Science 299(5609):1067-70

 [5] Sankar P., Lee JH., Shanmugam KT., 1985, Cloning of hydrogenase genes and fine structure analysis of an operon essential for H2 metabolism in Escherichia coli., J Bacteriol 162(1):353-60

 [6] Sankar P., Shanmugam KT., 1988, Biochemical and genetic analysis of hydrogen metabolism in Escherichia coli: the hydB gene., J Bacteriol 170(12):5433-9

 [7] Soboh B., Lindenstrauss U., Granich C., Javed M., Herzberg M., Thomas C., Stripp ST., 2014, [NiFe]-hydrogenase maturation in vitro: analysis of the roles of the HybG and HypD accessory proteins1., Biochem J 464(2):169-77

 [8] Yamamoto T., Tomiyama M., Mita H., Sode K., Karube I., 1990, Identification of proteins encoded in Escherichia coli hydA, hydB and analysis of the hydA locus., FEMS Microbiol Lett 54(1-3):187-92


RegulonDB