RegulonDB RegulonDB 10.8: Gene Form
   

ispA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dxs thiI ispA xseB TSS_539 TSS_539 thiIp thiIp xseBp xseBp TSS_538 (cluster) TSS_538 (cluster)

Gene      
Name: ispA    Texpresso search in the literature
Synonym(s): ECK0415, EG10508, b0421
Genome position(nucleotides): 440202 <-- 441101 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.22
External database links:  
ASAP:
ABE-0001463
CGSC:
30978
ECHOBASE:
EB0503
OU-MICROARRAY:
b0421
PortEco:
ispA
STRING:
511145.b0421
COLOMBOS: ispA


Shine dalgarno      
Sequence: cccttttacaCCGGACaatgagtAAT


Product      
Name: geranyl diphosphate/farnesyl diphosphate synthase
Synonym(s): IspA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.16
Isoelectric point: 5.181
Motif(s):
 
Type Positions Sequence
34 -> 271 ETMQYGALLGGKRLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDDAR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0004659 - prenyltransferase activity
GO:0004161 - dimethylallyltranstransferase activity
GO:0004337 - geranyltranstransferase activity
biological_process GO:0008299 - isoprenoid biosynthetic process
GO:0045337 - farnesyl diphosphate biosynthetic process
GO:0033384 - geranyl diphosphate biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Sherman MM., et al., 1989
External database links:  
DIP:
DIP-10044N
ECOCYC:
FPPSYN-MONOMER
ECOLIWIKI:
b0421
INTERPRO:
IPR000092
INTERPRO:
IPR033749
INTERPRO:
IPR008949
MINT:
MINT-1233182
MODBASE:
P22939
PANTHER:
PTHR12001
PDB:
1RQI
PDB:
1RQJ
PFAM:
PF00348
PRIDE:
P22939
PRODB:
PRO_000023034
PROSITE:
PS00444
PROSITE:
PS00723
REFSEQ:
NP_414955
SMR:
P22939
UNIPROT:
P22939


Operon      
Name: xseB-ispA-dxs-yajO         
Operon arrangement:
Transcription unit        Promoter
xseB-ispA-dxs-yajO
yajO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_538 (cluster) 439919 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_539 441469 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sherman MM., Petersen LA., Poulter CD., 1989, Isolation and characterization of isoprene mutants of Escherichia coli., J Bacteriol 171(7):3619-28

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB