RegulonDB RegulonDB 10.9: Gene Form
   

waaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

waaA coaD rirA Cis-reg TSS_4212 TSS_4212 waaAp1 waaAp1 waaAp2 waaAp2 rirAp rirAp waaQp waaQp

Gene      
Name: waaA    Texpresso search in the literature
Synonym(s): ECK3623, EG10520, b3633, kdtA
Genome position(nucleotides): 3808540 --> 3809817 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.91
External database links:  
ASAP:
ABE-0011873
CGSC:
33819
ECHOBASE:
EB0515
ECOLIHUB:
waaA
OU-MICROARRAY:
b3633
STRING:
511145.b3633
COLOMBOS: waaA


Product      
Name: KDO transferase
Synonym(s): KdtA, WaaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 47.291
Isoelectric point: 10.218
Motif(s):
 
Type Positions Sequence
3 -> 23 ELLYTALLYLIQPLIWIRLWV
335 -> 338 NPLE
33 -> 211 KRWGERYGFYRHPLKPGGIMLHSVSVGETLAAIPLVRALRHRYPDLPITVTTMTPTGSERVQSAFGKDVQHVYLPYDLPDALNRFLNKVDPKLVLIMETELWPNLIAALHKRKIPLVIANARLSARSAAGYAKLGKFVRRLLRRITLIAAQNEEDGARFVALGAKNNQVTVTGSLKFDI
309 -> 311 MGE
268 -> 269 PR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.3 - lipid A
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.5 - K antigen
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0043842 - Kdo transferase activity
GO:0016740 - transferase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0036104 - Kdo2-lipid A biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48036N
ECOCYC:
KDOTRANS-MONOMER
ECOLIWIKI:
b3633
INTERPRO:
IPR038107
INTERPRO:
IPR039901
INTERPRO:
IPR007507
MODBASE:
P0AC75
PANTHER:
PTHR42755
PFAM:
PF04413
PRIDE:
P0AC75
PRODB:
PRO_000024214
REFSEQ:
NP_418090
SMR:
P0AC75
UNIPROT:
P0AC75


Operon      
Name: waaA-coaD         
Operon arrangement:
Transcription unit        Promoter
waaA
kdtA-coaD
waaA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4212 3810040 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB