RegulonDB RegulonDB 10.9: Gene Form
   

malK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lamB malE malK MalT MalT MalT CRP CRP Fis CRP CRP MalT MalT CreB Fis terminator anti-terminator anti-anti-terminator malKp malKp malEp malEp

Gene      
Name: malK    Texpresso search in the literature
Synonym(s): ECK4027, EG10558, b4035, malB
Genome position(nucleotides): 4246784 --> 4247899 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.84
External database links:  
ASAP:
ABE-0013216
CGSC:
529
ECHOBASE:
EB0553
ECOLIHUB:
malK
OU-MICROARRAY:
b4035
STRING:
511145.b4035
COLOMBOS: malK


Product      
Name: maltose ABC transporter ATP binding subunit
Synonym(s): MalB, MalK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 40.99
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence
42 -> 42 K
106 -> 106 K
162 -> 165 SNLD
241 -> 241 F
20 -> 161 KDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031234 - extrinsic component of cytoplasmic side of plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060 - maltose transport complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015422 - ATPase-coupled oligosaccharide transmembrane transporter activity
GO:0015423 - ATPase-coupled maltose transmembrane transporter activity
GO:0033613 - activating transcription factor binding
biological_process GO:1904981 - maltose transmembrane transport
GO:0008643 - carbohydrate transport
GO:0015768 - maltose transport
GO:0042956 - maltodextrin transport
Note(s): Note(s): ...[more].
Reference(s): [1] Gilson E., et al., 1982
[2] Huang W., et al., 2016
[3] Kennedy KA., et al., 1999
[4] Lukman S., et al., 2009
[5] Mannering DE., et al., 2001
[6] Richet E., et al., 2005
[7] Schneider E., et al., 1995
[8] Wu S., et al., 2018
External database links:  
DIP:
DIP-47850N
ECOCYC:
MALK-MONOMER
ECOLIWIKI:
b4035
INTERPRO:
IPR008995
INTERPRO:
IPR015855
INTERPRO:
IPR003439
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR040582
INTERPRO:
IPR017871
MODBASE:
P68187
PDB:
2R6G
PDB:
4KI0
PDB:
4JBW
PDB:
3RLF
PDB:
3PV0
PDB:
3PUZ
PDB:
3PUY
PDB:
3PUX
PDB:
3PUW
PDB:
3PUV
PDB:
3GD7
PDB:
1Q1E
PDB:
1q12
PDB:
1q1b
PDB:
2awn
PDB:
2awo
PDB:
3FH6
PFAM:
PF17912
PFAM:
PF00005
PRIDE:
P68187
PRODB:
PRO_000023151
PROSITE:
PS00211
PROSITE:
PS51245
PROSITE:
PS50893
REFSEQ:
NP_418459
SMART:
SM00382
SMR:
P68187
UNIPROT:
P68187


Operon      
Name: malK-lamB-malM         
Operon arrangement:
Transcription unit        Promoter
malK-lamB-malM


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, MalT
Growth Conditions:

[1] 

C: Escherichia coli| 0.1 MPa
E: Escherichia coli| maltose 0.2%| 0.1 MPa

[2] 

C: Escherichia coli| maltose 0.2%| 0.1 MPa
E: Escherichia coli| maltose 0.2%| 10 to 40 MPa



RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Gilson E., Nikaido H., Hofnung M., 1982, Sequence of the malK gene in E.coli K12., Nucleic Acids Res 10(22):7449-58

 [2] Huang W., Liao JL., 2016, Catalytic Mechanism of the Maltose Transporter Hydrolyzing ATP., Biochemistry 55(1):224-31

 [3] Kennedy KA., Traxler B., 1999, MalK forms a dimer independent of its assembly into the MalFGK2 ATP-binding cassette transporter of Escherichia coli., J Biol Chem 274(10):6259-64

 [4] Lukman S., Grant GH., 2009, A network of dynamically conserved residues deciphers the motions of maltose transporter., Proteins 76(3):588-97

 [5] Mannering DE., Sharma S., Davidson AL., 2001, Demonstration of conformational changes associated with activation of the maltose transport complex., J Biol Chem 276(15):12362-8

 [6] Richet E., Joly N., Danot O., 2005, Two domains of MalT, the activator of the Escherichia coli maltose regulon, bear determinants essential for anti-activation by MalK., J Mol Biol 347(1):1-10

 [7] Schneider E., Hunke S., Tebbe S., 1995, The MalK protein of the ATP-binding cassette transporter for maltose of Escherichia coli is accessible to protease digestion from the periplasmic side of the membrane., J Bacteriol 177(18):5364-7

 [8] Wu S., Liu J., Wang W., 2018, Dissecting the Conformational Dynamics-Modulated Enzyme Catalysis with Single-Molecule FRET., J Phys Chem B 122(23):6179-6187


RegulonDB