RegulonDB RegulonDB 10.8: Gene Form
   

malZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malZ proY acpH MalT MalT MalT malZp malZp

Gene      
Name: malZ    Texpresso search in the literature
Synonym(s): ECK0397, EG10565, b0403
Genome position(nucleotides): 422518 --> 424332 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.6
External database links:  
ASAP:
ABE-0001402
CGSC:
29868
ECHOBASE:
EB0560
OU-MICROARRAY:
b0403
PortEco:
malZ
STRING:
511145.b0403
COLOMBOS: malZ


Shine dalgarno      
Sequence: attttcatcaCAGGGGaattatgATG


Product      
Name: maltodextrin glucosidase
Synonym(s): MalZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 69.041
Isoelectric point: 6.364
Motif(s):
 
Type Positions Sequence
546 -> 546 R
445 -> 445 D
177 -> 493 GDLDGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDPQFGGDGALLRLRHNTQQLGMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRDWYSFSDDGTALDWLGYASLPKLDYQSESLVNEIYRGEDSIVRHWLKAPWNMDGWRLDVVHMLGEAGGARNNMQHVAGITEAAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTFPLWGFLANTDISYDPQQIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGRDIARLPLAVVWLFTWPGVPCIYYGDEVGLDGKNDP
301 -> 301 L
1 -> 104 MLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNEEMSVPMHKQRSQPQPGVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPAR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.4 - polysaccharides
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004558 - alpha-1,4-glucosidase activity
GO:0032450 - maltose alpha-glucosidase activity
GO:0090599 - alpha-glucosidase activity
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0000023 - maltose metabolic process
GO:0030980 - alpha-glucan catabolic process
GO:0051692 - cellular oligosaccharide catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Goyal M., et al., 2015
[2] Jain N., et al., 2018
[3] Said-Salman IH., et al., 2019
External database links:  
CAZY:
CBM34
CAZY:
GH13
DIP:
DIP-10152N
ECOCYC:
MALTODEXGLUCOSID-MONOMER
ECOLIWIKI:
b0403
INTERPRO:
IPR006047
INTERPRO:
IPR017853
INTERPRO:
IPR017069
INTERPRO:
IPR014756
INTERPRO:
IPR013780
INTERPRO:
IPR004185
MINT:
P21517
MODBASE:
P21517
PANTHER:
PTHR10357
PDB:
5BN7
PFAM:
PF02903
PFAM:
PF00128
PRIDE:
P21517
PRODB:
PRO_000023158
REFSEQ:
NP_414937
SMART:
SM00642
SMR:
P21517
UNIPROT:
P21517


Operon      
Name: malZ         
Operon arrangement:
Transcription unit        Promoter
malZ


Transcriptional Regulation      
Display Regulation             
Activated by: MalT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Goyal M., Chaudhuri TK., 2015, GroEL-GroES assisted folding of multiple recombinant proteins simultaneously over-expressed in Escherichia coli., Int J Biochem Cell Biol 64:277-86

 [2] Jain N., Knowles TJ., Lund PA., Chaudhuri TK., 2018, Minichaperone (GroEL191-345) mediated folding of MalZ proceeds by binding and release of native and functional intermediates., Biochim Biophys Acta Proteins Proteom 1866(9):941-951

 [3] Said-Salman IH., Jebaii FA., Yusef HH., Moustafa ME., 2019, Global gene expression analysis of Escherichia coli K-12 DH5α after exposure to 2.4 GHz wireless fidelity radiation., Sci Rep 9(1):14425


RegulonDB