RegulonDB RegulonDB 10.9: Gene Form
   

metK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: metK    Texpresso search in the literature
Synonym(s): ECK2937, EG10589, b2942, metX
Genome position(nucleotides): 3086706 --> 3087860 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.25
External database links:  
ASAP:
ABE-0009650
CGSC:
507
ECHOBASE:
EB0584
ECOLIHUB:
metK
OU-MICROARRAY:
b2942
STRING:
511145.b2942
COLOMBOS: metK


Shine dalgarno      
Sequence: attctctttaGGTGATattaaatATG


Product      
Name: methionine adenosyltransferase
Synonym(s): MetK, MetX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.952
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
50 -> 61 MVLVGGEITTSA
90 -> 90 C
159 -> 161 PWL
233 -> 370 IGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEK
337 -> 337 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.20 - S-adenosyl methionine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004478 - methionine adenosyltransferase activity
GO:0000287 - magnesium ion binding
GO:0030955 - potassium ion binding
GO:0042802 - identical protein binding
biological_process GO:0006556 - S-adenosylmethionine biosynthetic process
GO:0006730 - one-carbon metabolic process
GO:0033353 - S-adenosylmethionine cycle
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35672N
ECOCYC:
S-ADENMETSYN-MONOMER
ECOLIWIKI:
b2942
INTERPRO:
IPR022636
INTERPRO:
IPR022631
INTERPRO:
IPR022629
INTERPRO:
IPR022630
INTERPRO:
IPR002133
INTERPRO:
IPR022628
MINT:
P0A817
PANTHER:
PTHR11964
PDB:
1MXB
PDB:
1XRC
PDB:
1XRB
PDB:
1XRA
PDB:
1RG9
PDB:
1FUG
PDB:
1MXA
PDB:
1MXC
PDB:
1P7L
PFAM:
PF02773
PFAM:
PF02772
PFAM:
PF00438
PRIDE:
P0A817
PRODB:
PRO_000023216
PROSITE:
PS00376
PROSITE:
PS00377
REFSEQ:
NP_417417
SMR:
P0A817
UNIPROT:
P0A817


Operon      
Name: metK         
Operon arrangement:
Transcription unit        Promoter
metK
metK


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP, MetJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3266 3086683 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3267 (cluster) 3087216 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3268 3087246 forward nd [RS-EPT-CBR] [1]
  promoter yggIp6 3089588 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yggIp3 3089659 forward Similarity to the consensus
Read more >
[ICWHO] [2]



RegulonDB