RegulonDB RegulonDB 10.8: Gene Form
   

nadA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nadA pnuC lysQ zitB NadR Cis-reg TSS_910 TSS_910 TSS_909 TSS_909 TSS_908 TSS_908 TSS_907 TSS_907 TSS_906 (cluster) TSS_906 (cluster) TSS_905 TSS_905 TSS_904 (cluster) TSS_904 (cluster) TSS_903 (cluster) TSS_903 (cluster) TSS_902 TSS_902 nadAp nadAp TSS_901 TSS_901 TSS_900 (cluster) TSS_900 (cluster) TSS_899 (cluster) TSS_899 (cluster)

Gene      
Name: nadA    Texpresso search in the literature
Synonym(s): ECK0739, EG10630, b0750, nicA
Genome position(nucleotides): 782085 --> 783128 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.19
External database links:  
ASAP:
ABE-0002541
CGSC:
467
ECHOBASE:
EB0624
OU-MICROARRAY:
b0750
PortEco:
nadA
STRING:
511145.b0750
COLOMBOS: nadA


Product      
Name: quinolinate synthase
Synonym(s): NadA, NicA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.241
Isoelectric point: 5.029
Motif(s):
 
Type Positions Sequence
35 -> 36 RL
153 -> 153 V
291 -> 291 C
31 -> 340 EKIKRLLKERNAVMVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKTILMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELIDHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAAILVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLEAPTAGEGATCRSCAHCPWMAMNGLQAIAEALEQEGSNHEVHVDERLRERALVPLNRMLD
170 -> 170 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.7 - nicotinamide adenine dinucleotide
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016765 - transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008987 - quinolinate synthetase A activity
biological_process GO:0009435 - NAD biosynthetic process
GO:0019363 - pyridine nucleotide biosynthetic process
GO:0034628 - 'de novo' NAD biosynthetic process from aspartate
GO:0019805 - quinolinate biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-1027N
ECOCYC:
QUINOLINATE-SYNTHA-MONOMER
ECOLIWIKI:
b0750
INTERPRO:
IPR036094
INTERPRO:
IPR023513
INTERPRO:
IPR003473
PANTHER:
PTHR30573
PFAM:
PF02445
PRIDE:
P11458
PRODB:
PRO_000023332
REFSEQ:
NP_415271
SMR:
P11458
UNIPROT:
P11458


Operon      
Name: nadA-pnuC         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Repressed by: NadR


RNA cis-regulatory element    
   
Cis-reg RtT RNA
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_899 (cluster) 782001 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_900 (cluster) 782008 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_901 782056 forward nd [RS-EPT-CBR] [1]
  promoter TSS_902 782098 forward nd [RS-EPT-CBR] [1]
  promoter TSS_903 (cluster) 782352 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_904 (cluster) 782372 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_905 782376 forward nd [RS-EPT-CBR] [1]
  promoter TSS_906 (cluster) 782394 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_907 782424 forward nd [RS-EPT-CBR] [1]
  promoter TSS_908 783540 forward nd [RS-EPT-CBR] [1]
  promoter TSS_909 783611 forward nd [RS-EPT-CBR] [1]
  promoter TSS_910 783630 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB