RegulonDB RegulonDB 10.8: Gene Form
   

nagE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nagE glnS nagB CRP NagC CRP NagC PhoP terminator anti-terminator TSS_812 TSS_812 TSS_811 TSS_811 TSS_810 TSS_810 TSS_809 TSS_809 glnSp1 glnSp1 glnSp2 glnSp2 nagEp nagEp TSS_806 TSS_806 TSS_805 (cluster) TSS_805 (cluster) nagBp nagBp TSS_804 TSS_804 TSS_803 (cluster) TSS_803 (cluster) TSS_802 TSS_802 nagAp nagAp

Gene      
Name: nagE    Texpresso search in the literature
Synonym(s): ECK0667, EG10635, b0679, pstN, ptsN
Genome position(nucleotides): 703944 --> 705890 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.75
External database links:  
ASAP:
ABE-0002312
CGSC:
38380
ECHOBASE:
EB0629
OU-MICROARRAY:
b0679
PortEco:
nagE
STRING:
511145.b0679
COLOMBOS: nagE


Product      
Name: N-acetylglucosamine-specific PTS enzyme IIABC component
Synonym(s): NagE, PstN, PtsN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 68.347
Isoelectric point: 6.071
Motif(s):
 
Type Positions Sequence
232 -> 252 GFFPIMMFGLPGAALAMYFAA
12 -> 300 RALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAGGAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIITGLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAGDGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLEFLFMFLAPLLYLLHALLTG
38 -> 58 VAFIAQAGGAIFDNLALIFAI
70 -> 90 GAAALAGAVGYFVLTKAMVTI
159 -> 179 IHAGGEWIVSAGALGSGIFGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.12 - amino sugar conversions
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0019866 - organelle inner membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0015572 - N-acetylglucosamine transmembrane transporter activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
GO:0090586 - protein-phosphocysteine-N-acetylglucosamine phosphotransferase system transporter activity
GO:0090587 - protein-phosphocysteine-glucosamine phosphotransferase system transporter activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0008643 - carbohydrate transport
GO:0009254 - peptidoglycan turnover
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
GO:0015764 - N-acetylglucosamine transport
External database links:  
ECOCYC:
NAGE-MONOMER
ECOLIWIKI:
b0679
INTERPRO:
IPR003352
INTERPRO:
IPR036878
INTERPRO:
IPR018113
INTERPRO:
IPR013013
INTERPRO:
IPR001127
INTERPRO:
IPR001996
INTERPRO:
IPR010974
INTERPRO:
IPR011055
MODBASE:
P09323
PFAM:
PF00367
PFAM:
PF00358
PFAM:
PF02378
PRIDE:
P09323
PRODB:
PRO_000023340
PROSITE:
PS51098
PROSITE:
PS00371
PROSITE:
PS01035
PROSITE:
PS51093
PROSITE:
PS51103
REFSEQ:
NP_415205
SMR:
P09323
SWISSMODEL:
P09323
UNIPROT:
P09323


Operon      
Name: nagE         
Operon arrangement:
Transcription unit        Promoter
nagE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_802 703631 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_803 (cluster) 703638 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_804 703655 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_805 (cluster) 703711 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_806 703828 forward nd [RS-EPT-CBR] [1]
  promoter TSS_809 706078 forward nd [RS-EPT-CBR] [1]
  promoter TSS_810 706086 forward nd [RS-EPT-CBR] [1]
  promoter TSS_811 706185 forward nd [RS-EPT-CBR] [1]
  promoter TSS_812 706250 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB