RegulonDB RegulonDB 10.9: Gene Form
   

narG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

narG narH narK narJ FNR NarL Fis NarL NarL NarL NarL Fis IHF NarL NarL NarL RstA TSS_1555 TSS_1555 narGp narGp

Gene      
Name: narG    Texpresso search in the literature
Synonym(s): ECK1218, EG10638, b1224, chlC, narC
Genome position(nucleotides): 1279864 --> 1283607 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.94
External database links:  
ASAP:
ABE-0004119
CGSC:
459
ECHOBASE:
EB0632
ECOLIHUB:
narG
OU-MICROARRAY:
b1224
STRING:
511145.b1224
COLOMBOS: narG


Product      
Name: nitrate reductase A subunit α
Synonym(s): ChlC, NarC, NarG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 140.489
Isoelectric point: 6.465
Motif(s):
 
Type Positions Sequence
10 -> 10 Y
1087 -> 1202 LNFLTPHQKWGIHSTYSDNLLMLTLGRGGPVVWLSEADAKDLGIADNDWIEVFNSNGALTARAVVSQRVPAGMTMMYHAQERIVNLPGSEITQQRGGIHNSVTRITPKPTHMIGGY
43 -> 107 DKIVRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSAN
50 -> 50 H
108 -> 833 RLKYPMMRKRLMKMWREAKALHSDPVEAWASIIEDADKAKSFKQARGRGGFVRSSWQEVNELIAASNVYTIKNYGPDRVAGFSPIPAMSMVSYASGARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPESADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQGTDAAMALAMGHVMLREFHLDNPSQYFTDYVRRYTDMPMLVMLEERDGYYAAGRMLRAADLVDALGQENNPEWKTVAFNTNGEMVAPNGSIGFRWGEKGKWNLEQRDGKTGEETELQLSLLGSQDEIAEVGFPYFGGDGTEHFNKVELENVLLHKLPVKRLQLADGSTALVTTVYDLTLANYGLERGLNDVNCATSYDDVKAYTPAWAEQITGVSRSQIIRIAREFADNADKTHGRSMIIVGAGLNHWYHLDMNYRGLINMLIFCGCVGQSGGGWAHYVGQEKLRPQTGWQPLAFALDWQRPARHMNSTSYFYNHSSQWRYETVTAEELLSPMADKSRYTGHLIDFNVRAERMGWLPSAPQLGTNPLTIAGEAEKAGMNPVDYTVKSLKEGSIRFAAEQPENGKNHPRNLFIWRSNLLGSSGKGHEFMLKYLLGTEHGIQGKDLGQQGGVKPEEVDWQDNGLEGKLDLVVTLDFRLSSTCLYSDIILPTATWYEKDDMNTSDMHPFIHPLSAAVDPAWEAKSDWEIYKAIAKK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031224 - intrinsic component of membrane
GO:0031235 - intrinsic component of the cytoplasmic side of the plasma membrane
GO:0009325 - nitrate reductase complex
GO:0044799 - NarGHI complex
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008940 - nitrate reductase activity
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0009061 - anaerobic respiration
GO:0042126 - nitrate metabolic process
GO:0042128 - nitrate assimilation
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Rothery RA., et al., 2004
External database links:  
DIP:
DIP-10311N
ECOCYC:
NARG-MONOMER
ECOLIWIKI:
b1224
INTERPRO:
IPR006656
INTERPRO:
IPR006963
INTERPRO:
IPR006657
INTERPRO:
IPR006468
INTERPRO:
IPR006655
INTERPRO:
IPR027467
INTERPRO:
IPR028189
INTERPRO:
IPR037943
INTERPRO:
IPR009010
MINT:
P09152
MODBASE:
P09152
PDB:
1R27
PDB:
3IR5
PDB:
3EGW
PDB:
1Y5N
PDB:
1Y5L
PDB:
3IR7
PDB:
1Q16
PDB:
3IR6
PDB:
1SIW
PDB:
1Y4Z
PDB:
1Y5I
PFAM:
PF00384
PFAM:
PF14710
PFAM:
PF01568
PRIDE:
P09152
PRODB:
PRO_000023351
PROSITE:
PS00551
PROSITE:
PS00932
PROSITE:
PS51669
PROSITE:
PS00490
REFSEQ:
NP_415742
SMART:
SM00926
SMR:
P09152
UNIPROT:
P09152


Operon      
Name: narGHJI         
Operon arrangement:
Transcription unit        Promoter
narGHJI


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, NarL, RstA
Repressed by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1555 1280972 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Rothery RA., Bertero MG., Cammack R., Palak M., Blasco F., Strynadka NC., Weiner JH., 2004, The catalytic subunit of Escherichia coli nitrate reductase A contains a novel [4Fe-4S] cluster with a high-spin ground state., Biochemistry 43(18):5324-33

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB