RegulonDB RegulonDB 10.8: Gene Form
   

nusB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: nusB    Texpresso search in the literature
Synonym(s): ECK0410, EG10666, b0416, groNB, ssaD, ssyB
Genome position(nucleotides): 435137 --> 435556 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.81
External database links:  
ASAP:
ABE-0001447
CGSC:
440
ECHOBASE:
EB0660
OU-MICROARRAY:
b0416
PortEco:
nusB
STRING:
511145.b0416
COLOMBOS: nusB


Product      
Name: transcription antitermination protein NusB
Synonym(s): NusB, SsaD, SsyB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.689
Isoelectric point: 7.351
Motif(s):
 
Type Positions Sequence
7 -> 131 RRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAINEAIELAKSFGAEDSHKFVNGVLDKAA
59 -> 59 T
18 -> 18 Y

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0003723 - RNA binding
biological_process GO:0006353 - DNA-templated transcription, termination
GO:0006355 - regulation of transcription, DNA-templated
GO:0031564 - transcription antitermination
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Kuroki K., et al., 1982
[2] Strauch M., et al., 1981
External database links:  
DIP:
DIP-48254N
ECOCYC:
EG10666-MONOMER
ECOLIWIKI:
b0416
INTERPRO:
IPR035926
INTERPRO:
IPR011605
INTERPRO:
IPR006027
MINT:
MINT-1220894
MODBASE:
P0A780
PANTHER:
PTHR11078
PDB:
3IMQ
PDB:
5MS0
PDB:
3D3B
PDB:
1EY1
PDB:
3D3C
PFAM:
PF01029
PRIDE:
P0A780
PRODB:
PRO_000023446
REFSEQ:
NP_414950
SMR:
P0A780
UNIPROT:
P0A780


Operon      
Name: nrdR-ribDE-nusB-thiL-pgpA         
Operon arrangement:
Transcription unit        Promoter
nrdR-ribDE-nusB-thiL-pgpA
ribE-nusB-thiL-pgpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_535 434974 forward nd [RS-EPT-CBR] [3]
  promoter TSS_536 436581 forward nd [RS-EPT-CBR] [3]



RegulonDB