RegulonDB RegulonDB 10.9: Gene Form
   

phnG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnI phnF phnH phnG phnJ

Gene      
Name: phnG    Texpresso search in the literature
Synonym(s): ECK4094, EG10716, b4101
Genome position(nucleotides): 4321244 <-- 4321696 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
62.69
External database links:  
ASAP:
ABE-0013433
CGSC:
34544
ECHOBASE:
EB0710
ECOLIHUB:
phnG
OU-MICROARRAY:
b4101
STRING:
511145.b4101
COLOMBOS: phnG


Product      
Name: carbon-phosphorus lyase core complex subunit PhnG
Synonym(s): PhnG, PhnG subunit of methylphosphonate degradation complex
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.54
Isoelectric point: 7.073
Motif(s):
 
Type Positions Sequence
85 -> 85 Q
7 -> 147 TRQHWMSVLAHSQPAELAARLNALNITADYEVIRAAETGLVQIQARMGGTGERFFAGDATLTRAAVRLTDGTLGYSWVQGRDKQHAERCALIDALMQQSRHFQNLSETLIAPLDADRMARIAARQAEVNASRVDFFTMVRG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:1904176 - carbon phosphorus lyase complex
GO:0005829 - cytosol
GO:0061694 - alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase complex
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0061693 - alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase activity
biological_process GO:0015716 - organic phosphonate transport
GO:0019634 - organic phosphonate metabolic process
GO:0019700 - organic phosphonate catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10486N
ECOCYC:
EG10716-MONOMER
ECOLIWIKI:
b4101
INTERPRO:
IPR009609
PDB:
4XB6
PFAM:
PF06754
PRIDE:
P16685
REFSEQ:
NP_418525
SMR:
P16685
UNIPROT:
P16685


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB