RegulonDB RegulonDB 10.9: Gene Form
   

phoR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

brnQ phoR phoB anti-terminator anti-anti-terminator TSS_507 TSS_507 TSS_506 TSS_506 TSS_505 TSS_505 TSS_504 (cluster) TSS_504 (cluster) TSS_503 TSS_503 brnQp brnQp TSS_502 TSS_502

Gene      
Name: phoR    Texpresso search in the literature
Synonym(s): ECK0394, EG10733, R1pho, b0400, nmpB, phoR1
Genome position(nucleotides): 417889 --> 419184 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.01
External database links:  
ASAP:
ABE-0001391
CGSC:
394
ECHOBASE:
EB0726
ECOLIHUB:
phoR
OU-MICROARRAY:
b0400
STRING:
511145.b0400
COLOMBOS: phoR


Product      
Name: sensor histidine kinase PhoR
Synonym(s): NmpB, PhoR
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 49.629
Isoelectric point: 10.116
Motif(s):
 
Type Positions Sequence
10 -> 28 LVLELLLCCLPAFILGAFF
99 -> 194 RFRSGAESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSRPLNLVLNTGRHLEIRVMPYTHKQLLMVARDV
210 -> 425 NVSHELRTPLTVLQGYLEMMNEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTHLLNEKVDVPMMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHITVRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTVGKGTRFSFVIPERL
220 -> 220 T
204 -> 268 RRNFFANVSHELRTPLTVLQGYLEMMNEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006470 - protein dephosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0006817 - phosphate ion transport
GO:0016036 - cellular response to phosphate starvation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
External database links:  
DIP:
DIP-10502N
ECOCYC:
PHOR-MONOMER
ECOLIWIKI:
b0400
INTERPRO:
IPR003661
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR035965
INTERPRO:
IPR021766
INTERPRO:
IPR014310
INTERPRO:
IPR013767
INTERPRO:
IPR005467
INTERPRO:
IPR000014
INTERPRO:
IPR003594
INTERPRO:
IPR004358
MODBASE:
P08400
PFAM:
PF00512
PFAM:
PF02518
PFAM:
PF11808
PFAM:
PF00989
PRIDE:
P08400
PRINTS:
PR00344
PRODB:
PRO_000023546
PROSITE:
PS50109
PROSITE:
PS50112
REFSEQ:
NP_414934
SMART:
SM00388
SMART:
SM00091
SMART:
SM00387
SMR:
P08400
UNIPROT:
P08400


Operon      
Name: phoBR         
Operon arrangement:
Transcription unit        Promoter
phoBR


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_502 419419 forward nd [RS-EPT-CBR] [1]
  promoter TSS_503 419509 forward nd [RS-EPT-CBR] [1]
  promoter TSS_504 (cluster) 419551 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_505 419559 forward nd [RS-EPT-CBR] [1]
  promoter TSS_506 419571 forward nd [RS-EPT-CBR] [1]
  promoter TSS_507 420215 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB