RegulonDB RegulonDB 10.9: Gene Form
   

ppa gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ytfQ ppa chpB chpS anti-anti-terminator anti-terminator terminator ytfQp6 ytfQp6 ppap ppap TSS_5080 (cluster) TSS_5080 (cluster) TSS_5079 TSS_5079

Gene      
Name: ppa    Texpresso search in the literature
Synonym(s): ECK4222, EG10755, b4226
Genome position(nucleotides): 4449122 <-- 4449652 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.22
External database links:  
ASAP:
ABE-0013824
CGSC:
34394
ECHOBASE:
EB0748
ECOLIHUB:
ppa
OU-MICROARRAY:
b4226
STRING:
511145.b4226
COLOMBOS: ppa


Product      
Name: inorganic pyrophosphatase
Synonym(s): Ppa
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.704
Isoelectric point: 4.8
Motif(s):
 
Type Positions Sequence
18 -> 173 VVIEIPANADPIKYEIDKESGALFVDRFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERA
52 -> 52 Y
56 -> 56 Y
66 -> 66 D
44 -> 44 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0004427 - inorganic diphosphatase activity
GO:0000287 - magnesium ion binding
GO:0050355 - triphosphatase activity
biological_process GO:0006796 - phosphate-containing compound metabolic process
Reference(s): [1] Lahti R., et al., 1990
[2] Lahti R., et al., 1988
External database links:  
DIP:
DIP-36217N
ECOCYC:
INORGPYROPHOSPHAT-MONOMER
ECOLIWIKI:
b4226
INTERPRO:
IPR036649
INTERPRO:
IPR008162
PANTHER:
PTHR10286
PDB:
1JFD
PDB:
4UM4
PDB:
2EIP
PDB:
2AUU
PDB:
2AU9
PDB:
2AU8
PDB:
1FAJ
PDB:
1I40
PDB:
1I6T
PDB:
1IGP
PDB:
1INO
PDB:
1IPW
PDB:
1MJW
PDB:
1MJX
PDB:
1MJY
PDB:
1MJZ
PDB:
1OBW
PDB:
2AU6
PDB:
2AU7
PFAM:
PF00719
PRIDE:
P0A7A9
PROSITE:
PS00387
REFSEQ:
NP_418647
SMR:
P0A7A9
UNIPROT:
P0A7A9


Operon      
Name: ppa         
Operon arrangement:
Transcription unit        Promoter
ppA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5079 4448709 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5080 (cluster) 4449647 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter ytfQp6 4449817 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lahti R., Kolakowski LF., Heinonen J., Vihinen M., Pohjanoksa K., Cooperman BS., 1990, Conservation of functional residues between yeast and E. coli inorganic pyrophosphatases., Biochim Biophys Acta 1038(3):338-45

 [2] Lahti R., Pitkaranta T., Valve E., Ilta I., Kukko-Kalske E., Heinonen J., 1988, Cloning and characterization of the gene encoding inorganic pyrophosphatase of Escherichia coli K-12., J Bacteriol 170(12):5901-7

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB