RegulonDB RegulonDB 10.8: Gene Form
   

pyrF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lapB pyrF yciH osmB pyrFp pyrFp

Gene      
Name: pyrF    Texpresso search in the literature
Synonym(s): ECK1276, EG10809, b1281
Genome position(nucleotides): 1341921 --> 1342658 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.98
External database links:  
ASAP:
ABE-0004304
CGSC:
326
ECHOBASE:
EB0802
OU-MICROARRAY:
b1281
PortEco:
pyrF
STRING:
511145.b1281
COLOMBOS: pyrF


Product      
Name: orotidine-5'-phosphate decarboxylase
Synonym(s): PyrF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.35
Isoelectric point: 6.122
Motif(s):
 
Type Positions Sequence
15 -> 237 SPVVVALDYHNRDDALAFVDKIDPRDCRLKVGKEMFTLFGPQFVRELQQRGFDIFLDLKFHDIPNTAAHAVAAAADLGVWMVNVHASGGARMMTAAREALVPFGKDAPLLIAVTVLTSMEASDLVDLGMTLSPADYAERLAALTQKCGLDGVVCSAQEAVRFKQVFGQEFKLVTPGIRPQGSEAGDQRRIMTPEQALSAGVDYMVIGRPVTQSVDPAQTLKAI
71 -> 80 DLKFHDIPNT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.2 - pyrimidine biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0016831 - carboxy-lyase activity
GO:0004590 - orotidine-5'-phosphate decarboxylase activity
biological_process GO:0006221 - pyrimidine nucleotide biosynthetic process
GO:0015949 - nucleobase-containing small molecule interconversion
GO:0006207 - 'de novo' pyrimidine nucleobase biosynthetic process
GO:0044205 - 'de novo' UMP biosynthetic process
External database links:  
ECOCYC:
OROTPDECARB-MONOMER
ECOLIWIKI:
b1281
INTERPRO:
IPR018089
INTERPRO:
IPR014732
INTERPRO:
IPR013785
INTERPRO:
IPR011060
INTERPRO:
IPR001754
MODBASE:
P08244
PANTHER:
PTHR32119:SF2
PDB:
1L2U
PDB:
1JJK
PDB:
1EIX
PFAM:
PF00215
PRIDE:
P08244
PRODB:
PRO_000023661
PROSITE:
PS00156
REFSEQ:
NP_415797
SMART:
SM00934
SMR:
P08244
UNIPROT:
P08244


Operon      
Name: lapAB-pyrF-yciH         
Operon arrangement:
Transcription unit        Promoter
lapAB
yciSM-pyrF-yciH
lapAB
pyrF-yciH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB