RegulonDB RegulonDB 10.9: Gene Form
   

rbsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rbsA rbsC rbsD TSS_4364 (cluster) TSS_4364 (cluster) TSS_4363 (cluster) TSS_4363 (cluster) TSS_4362 TSS_4362 TSS_4361 TSS_4361 TSS_4360 TSS_4360

Gene      
Name: rbsA    Texpresso search in the literature
Synonym(s): ECK3743, EG10814, b3749, rbsP, rbsT
Genome position(nucleotides): 3933778 --> 3935283 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.2
External database links:  
ASAP:
ABE-0012259
CGSC:
12082
ECHOBASE:
EB0807
ECOLIHUB:
rbsA
OU-MICROARRAY:
b3749
STRING:
511145.b3749
COLOMBOS: rbsA


Product      
Name: ribose ABC transporter ATP binding subunit
Synonym(s): RbsA, RbsP, RbsT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.042
Isoelectric point: 5.995
Motif(s):
 
Type Positions Sequence
22 -> 169 GAALNVYPGRVMALVGENGAGKSTMMKVLTGIYTRDAGTLLWLGKETTFTGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGREFVNRFGKIDWKTMYAEADKLLAKLNLRFKSDKLVGDLSIGDQQMVEIAKVLSFESKVIIMDEPT
162 -> 169 VIIMDEPT
252 -> 495 APGDIRLKVDNLCGPGVNDVSFTLRKGEILGVSGLMGAGRTELMKVLYGALPRTSGYVTLDGHEVVTRSPQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYFSRAGGSLKHADEQQAVSDFIRLFNVKTPSMEQAIGLLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKADGLSIILVSSEMPEVLGMSDRIIVMHEGHLSGEFTREQATQEVLMAAAVGKL
269 -> 423 NDVSFTLRKGEILGVSGLMGAGRTELMKVLYGALPRTSGYVTLDGHEVVTRSPQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYFSRAGGSLKHADEQQAVSDFIRLFNVKTPSMEQAIGLLSGGNQQKVAIARGLMTRPKVLILDEPT
396 -> 399 LSGG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015407 - ATPase-coupled monosaccharide transmembrane transporter activity
GO:0015591 - D-ribose transmembrane transporter activity
GO:0043211 - ATPase-coupled carbohydrate transmembrane transporter activity
GO:0015611 - D-ribose-importing ATPase activity
biological_process GO:0008643 - carbohydrate transport
GO:0015752 - D-ribose transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10640N
ECOCYC:
RBSA-MONOMER
ECOLIWIKI:
b3749
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR015861
INTERPRO:
IPR003439
MODBASE:
P04983
PFAM:
PF00005
PRIDE:
P04983
PRODB:
PRO_000023682
PROSITE:
PS50893
PROSITE:
PS00211
PROSITE:
PS51254
REFSEQ:
NP_418205
SMART:
SM00382
SMR:
P04983
UNIPROT:
P04983


Operon      
Name: rbsDACBKR         
Operon arrangement:
Transcription unit        Promoter
rbsDACBKR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: RbsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4360 3935432 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4361 3936137 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4362 3936145 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4363 (cluster) 3936163 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4364 (cluster) 3936177 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB