RegulonDB RegulonDB 10.9: Gene Form
   

rbsR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hsrA rbsR rbsK yieP hsrAp6 hsrAp6 hsrAp4 hsrAp4

Gene      
Name: rbsR    Texpresso search in the literature
Synonym(s): ECK3747, EG10819, b3753
Genome position(nucleotides): 3938227 --> 3939219 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.65
External database links:  
ASAP:
ABE-0012271
CGSC:
12086
ECHOBASE:
EB0812
ECOLIHUB:
rbsR
OU-MICROARRAY:
b3753
STRING:
511145.b3753
COLOMBOS: rbsR


Product      
Name: DNA-binding transcriptional dual regulator RbsR
Synonym(s): RbsR, regulator for rbs operon
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 36.612
Isoelectric point: 5.219
Motif(s):
 
Type Positions Sequence
4 -> 23 MKDVARLAGVSTSTVSHVIN
169 -> 329 TQYLIDKGHTRIACITGPLDKTPARLRLEGYRAAMKRAGLNIPDGYEVTGDFEFNGGFDAMRQLLSHPLRPQAVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELASFMTPPLTTIHQPKDELGELAIDVLIHRITQPTLQQQRLQLTPILMERGS
12 -> 13 GV
3 -> 48 TMKDVARLAGVSTSTVSHVINKDRFVSEAITAKVEAAIKELNYAPS
2 -> 56 ATMKDVARLAGVSTSTVSHVINKDRFVSEAITAKVEAAIKELNYAPSALARSLKL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0048029 - monosaccharide binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Burland V., et al., 1993
[2] Mauzy CA., et al., 1992
External database links:  
ECOCYC:
PD03867
ECOLIWIKI:
b3753
INTERPRO:
IPR010982
INTERPRO:
IPR028082
INTERPRO:
IPR000843
PFAM:
PF13377
PFAM:
PF00356
PRIDE:
P0ACQ0
PRINTS:
PR00036
PRODB:
PRO_000023686
PROSITE:
PS50932
PROSITE:
PS00356
REFSEQ:
NP_418209
SMART:
SM00354
SMR:
P0ACQ0
SWISSMODEL:
P0ACQ0
UNIPROT:
P0ACQ0


Operon      
Name: rbsDACBKR         
Operon arrangement:
Transcription unit        Promoter
rbsDACBKR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: RbsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hsrAp4 3940643 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter hsrAp6 3940706 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Burland V., Plunkett G., Daniels DL., Blattner FR., 1993, DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication., Genomics 16(3):551-61

 [2] Mauzy CA., Hermodson MA., 1992, Structural homology between rbs repressor and ribose binding protein implies functional similarity., Protein Sci 1(7):843-9

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB