RegulonDB RegulonDB 10.9: Gene Form
   

rhaS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhaB rhaR rhaS rhaA rhaT RhaS RhaS RhaR RhaS RhaR CRP CRP CRP CRP RhaS RhaS rhaSp rhaSp rhaBp rhaBp

Gene      
Name: rhaS    Texpresso search in the literature
Synonym(s): ECK3898, EG10843, b3905, rhaC2
Genome position(nucleotides): 4097736 --> 4098572 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.85
External database links:  
ASAP:
ABE-0012745
CGSC:
17950
ECHOBASE:
EB0836
ECOLIHUB:
rhaS
OU-MICROARRAY:
b3905
STRING:
511145.b3905
COLOMBOS: rhaS


Shine dalgarno      
Sequence: tgacgacatcAGGAGGccagtATG


Product      
Name: DNA-binding transcriptional activator RhaS
Synonym(s): RhaS
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 32.315
Isoelectric point: 6.664
Motif(s):
 
Type Positions Sequence
256 -> 256 T
206 -> 206 R
252 -> 252 N
16 -> 154 SVAIEPRLPQADFPEHHHDFHEIVIVEHGTGIHVFNGQPYTITGGTVCFVRDHDRHLYEHTDNLCLTNVLYRSPDRFQFLAGLNQLLPQELDGQYPSHWRVNHSVLQQVRQLVAQMEQQEGENDLPSTASREILFMQLL
246 -> 246 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0019299 - rhamnose metabolic process
GO:0045893 - positive regulation of transcription, DNA-templated
Reference(s): [1] Egan SM., et al., 1993
[2] Plunkett G., et al., 1993
[3] Tobin JF., et al., 1987
External database links:  
DIP:
DIP-10694N
ECOCYC:
PD00221
ECOLIWIKI:
b3905
INTERPRO:
IPR018060
INTERPRO:
IPR037923
INTERPRO:
IPR023609
INTERPRO:
IPR020449
INTERPRO:
IPR018062
INTERPRO:
IPR014710
INTERPRO:
IPR009057
INTERPRO:
IPR003313
MODBASE:
P09377
PFAM:
PF02311
PFAM:
PF12833
PRIDE:
P09377
PRINTS:
PR00032
PRODB:
PRO_000023738
PROSITE:
PS01124
PROSITE:
PS00041
REFSEQ:
NP_418341
SMART:
SM00342
SMR:
P09377
UNIPROT:
P09377


Operon      
Name: rhaSR         
Operon arrangement:
Transcription unit        Promoter
rhaSR
rhaSR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, RhaR, RhaS
Undetermined regulation RhaS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Egan SM., Schleif RF., 1993, A regulatory cascade in the induction of rhaBAD., J Mol Biol 234(1):87-98

 [2] Plunkett G., Burland V., Daniels DL., Blattner FR., 1993, Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes., Nucleic Acids Res 21(15):3391-8

 [3] Tobin JF., Schleif RF., 1987, Positive regulation of the Escherichia coli L-rhamnose operon is mediated by the products of tandemly repeated regulatory genes., J Mol Biol 196(4):789-99


RegulonDB