RegulonDB RegulonDB 10.10: Gene Form
   

rpoB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpoC rpoB rplL terminator TSS_4816 TSS_4816 TSS_4815 TSS_4815 TSS_4814 TSS_4814 TSS_4813 TSS_4813 TSS_4812 TSS_4812 TSS_4811 TSS_4811 TSS_4810 TSS_4810 TSS_4809 TSS_4809 TSS_4808 TSS_4808 TSS_4807 (cluster) TSS_4807 (cluster) TSS_4806 TSS_4806 TSS_4805 TSS_4805 TSS_4804 TSS_4804 TSS_4803 TSS_4803 TSS_4802 TSS_4802 TSS_4801 TSS_4801 TSS_4800 TSS_4800 TSS_4799 TSS_4799 TSS_4798 TSS_4798 TSS_4797 TSS_4797 TSS_4796 TSS_4796 TSS_4795 TSS_4795 TSS_4794 TSS_4794 TSS_4793 TSS_4793 TSS_4792 TSS_4792 TSS_4791 TSS_4791 TSS_4790 TSS_4790 TSS_4789 TSS_4789 TSS_4788 TSS_4788 TSS_4787 TSS_4787 TSS_4786 TSS_4786 TSS_4785 (cluster) TSS_4785 (cluster) TSS_4784 TSS_4784 TSS_4783 TSS_4783 TSS_4782 TSS_4782 TSS_4781 TSS_4781 TSS_4780 TSS_4780 TSS_4779 TSS_4779 TSS_4778 TSS_4778 TSS_4777 TSS_4777 TSS_4776 TSS_4776 TSS_4775 TSS_4775 TSS_4774 TSS_4774 TSS_4773 TSS_4773 TSS_4772 TSS_4772 TSS_4771 TSS_4771 TSS_4770 TSS_4770 TSS_4769 TSS_4769 TSS_4768 TSS_4768 TSS_4767 TSS_4767 TSS_4766 (cluster) TSS_4766 (cluster) TSS_4765 TSS_4765 TSS_4764 TSS_4764 rpoBp rpoBp TSS_4763 TSS_4763 TSS_4762 TSS_4762 TSS_4761 (cluster) TSS_4761 (cluster) TSS_4760 (cluster) TSS_4760 (cluster) TSS_4759 TSS_4759 TSS_4758 TSS_4758

Gene      
Name: rpoB    Texpresso search in the literature
Synonym(s): ECK3978, EG10894, b3987, ftsR, groN, nitB, rif, ron, sdgB, stl, stv, tabD
Genome position(nucleotides): 4181245 --> 4185273 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.62
External database links:  
ASAP:
ABE-0013041
CGSC:
233
ECHOBASE:
EB0887
ECOLIHUB:
rpoB
OU-MICROARRAY:
b3987
STRING:
511145.b3987
COLOMBOS: rpoB


Product      
Name: RNA polymerase subunit β
Synonym(s): FtsR, GroN, NitB, Rif, Ron, RpoB, SdgB, Stl, Stv, TabD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 150.632
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
151 -> 225 RSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFF
677 -> 677 N
1104 -> 1107 PSRM
1266 -> 1340 GGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELE
26 -> 500 YLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGILSKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0003677 - DNA binding
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0003899 - DNA-directed 5'-3' RNA polymerase activity
GO:0032549 - ribonucleoside binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Braberg H., et al., 2020
External database links:  
DIP:
DIP-35777N
ECOCYC:
RPOB-MONOMER
ECOLIWIKI:
b3987
INTERPRO:
IPR007120
INTERPRO:
IPR007121
INTERPRO:
IPR007641
INTERPRO:
IPR007642
INTERPRO:
IPR007644
INTERPRO:
IPR037034
INTERPRO:
IPR010243
INTERPRO:
IPR014724
INTERPRO:
IPR015712
INTERPRO:
IPR019462
INTERPRO:
IPR037033
INTERPRO:
IPR007645
MODBASE:
P0A8V2
PANTHER:
PTHR20856
PDB:
6FLP
PDB:
6FLQ
PDB:
6GFW
PDB:
6GH5
PDB:
6GH6
PDB:
6JBQ
PDB:
6JNX
PDB:
6K4Y
PDB:
6KJ6
PDB:
6N57
PDB:
6N58
PDB:
6N60
PDB:
6N61
PDB:
6OMF
PDB:
6P18
PDB:
6P19
PDB:
6R9B
PDB:
6R9G
PDB:
6RH3
PDB:
6RI7
PDB:
6RI9
PDB:
6RIN
PDB:
6RIP
PDB:
6WR6
PDB:
6WRD
PDB:
3IYD
PDB:
3LTI
PDB:
3LU0
PDB:
3T72
PDB:
3TBI
PDB:
4JK1
PDB:
4JK2
PDB:
4KMU
PDB:
4KN4
PDB:
4KN7
PDB:
4MEX
PDB:
4MEY
PDB:
4S20
PDB:
4XSX
PDB:
4XSY
PDB:
4XSZ
PDB:
4YG2
PDB:
4YLN
PDB:
4YLO
PDB:
4YLP
PDB:
4ZH2
PDB:
4ZH3
PDB:
4ZH4
PDB:
5BYH
PDB:
5EZK
PDB:
5IPL
PDB:
5IPM
PDB:
5IPN
PDB:
5MS0
PDB:
5MY1
PDB:
5NSR
PDB:
5NSS
PDB:
5NWT
PDB:
5UAC
PDB:
5UAG
PDB:
5UAH
PDB:
5UAJ
PDB:
5UAL
PDB:
5UAQ
PDB:
5VSW
PDB:
5VT0
PDB:
5W1S
PDB:
5W1T
PDB:
6ALF
PDB:
6ALG
PDB:
6ALH
PDB:
6ASX
PDB:
6BJS
PDB:
6BYU
PDB:
6C6S
PDB:
6C6T
PDB:
6C6U
PDB:
6C9Y
PDB:
6CA0
PDB:
6CUX
PFAM:
PF04563
PFAM:
PF10385
PFAM:
PF04565
PFAM:
PF00562
PFAM:
PF04560
PFAM:
PF04561
PRIDE:
P0A8V2
PRODB:
PRO_000023845
PROSITE:
PS01166
REFSEQ:
NP_418414
SMR:
P0A8V2
SWISSMODEL:
P0A8V2
UNIPROT:
P0A8V2


Operon      
Name: rplKAJL-rpoBC         
Operon arrangement:
Transcription unit        Promoter
rplKAJL-rpoBC
rplJL-rpoBC
rpoBC
rplL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4758 4180562 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4759 4180564 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4760 (cluster) 4180570 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4761 (cluster) 4180576 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4762 4180581 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4763 4180584 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4764 4181137 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4765 4181601 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4766 (cluster) 4181777 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4767 4181787 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4768 4181927 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4769 4181929 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4770 4181932 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4771 4182185 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4772 4182197 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4773 4182221 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4774 4182784 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4775 4182797 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4776 4182947 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4777 4183051 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4778 4183955 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4779 4184263 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4780 4184265 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4781 4184369 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4782 4184971 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4783 4185358 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4784 4185368 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4785 (cluster) 4185549 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4786 4185586 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4787 4185599 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4788 4185695 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4789 4185757 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4790 4185780 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4791 4185843 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4792 4185874 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4793 4185950 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4794 4186015 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4795 4186042 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4796 4186146 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4797 4186176 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4798 4186193 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4799 4186200 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4800 4186215 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4801 4186234 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4802 4186296 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4803 4186488 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4804 4186490 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4805 4186492 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4806 4186542 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4807 (cluster) 4186544 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4808 4186806 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4809 4187081 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4810 4187339 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4811 4187568 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4812 4187724 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4813 4188172 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4814 4188174 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4815 4188210 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4816 4188934 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Braberg H., Echeverria I., Bohn S., Cimermancic P., Shiver A., Alexander R., Xu J., Shales M., Dronamraju R., Jiang S., Dwivedi G., Bogdanoff D., Chaung KK., Huttenhain R., Wang S., Mavor D., Pellarin R., Schneidman D., Bader JS., Fraser JS., Morris J., Haber JE., Strahl BD., Gross CA., Dai J., Boeke JD., Sali A., Krogan NJ., 2020, Genetic interaction mapping informs integrative structure determination of protein complexes., Science 370(6522)

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB