RegulonDB RegulonDB 10.9: Gene Form
   

sbcC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sbcC sbcD araJ phoB PhoB CRP AraC AraC CRP anti-anti-terminator anti-terminator terminator phoBp phoBp sbcDp sbcDp sbcCp2 sbcCp2 araJp araJp

Gene      
Name: sbcC    Texpresso search in the literature
Synonym(s): ECK0391, EG10927, b0397
Genome position(nucleotides): 412607 <-- 415753 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.8
External database links:  
ASAP:
ABE-0001381
CGSC:
17917
ECHOBASE:
EB0920
ECOLIHUB:
sbcC
OU-MICROARRAY:
b0397
STRING:
511145.b0397
COLOMBOS: sbcC


Product      
Name: ATP-dependent structure-specific DNA nuclease - SbcC subunit
Synonym(s): SbcC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 118.721
Isoelectric point: 5.436
Motif(s):
 
Type Positions Sequence
5 -> 206 SLRLKNLNSLKGEWKIDFTREPFASNGLFAITGPTGAGKTTLLDAICLALYHETPRLSNVSQSQNDLMTRDTAECLAEVEFEVKGEAYRAFWSQNRARNQPDGNLQVPRVELARCADGKILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQFAAFLNAKPKERAELLEELTGTEIYGQISAMVFEQHKSARTELEKLQAQ
931 -> 1002 ALEVEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLDSETLDTALDALD
37 -> 44 GPTGAGKT
980 -> 985 LFLDEG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0004527 - exonuclease activity
GO:0004529 - exodeoxyribonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0008296 - 3'-5'-exodeoxyribonuclease activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:1990238 - double-stranded DNA endodeoxyribonuclease activity
GO:0000014 - single-stranded DNA endodeoxyribonuclease activity
biological_process GO:0006260 - DNA replication
GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006274 - DNA replication termination
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Lloyd RG., et al., 1985
External database links:  
DIP:
DIP-342N
ECOCYC:
EG10927-MONOMER
ECOLIWIKI:
b0397
INTERPRO:
IPR004592
INTERPRO:
IPR038729
INTERPRO:
IPR027417
MODBASE:
P13458
PDB:
6S6V
PDB:
6S85
PFAM:
PF13558
PFAM:
PF13476
PRIDE:
P13458
PRODB:
PRO_000023910
REFSEQ:
NP_414931
SMR:
P13458
UNIPROT:
P13458


Operon      
Name: sbcDC         
Operon arrangement:
Transcription unit        Promoter
sbcDC


Transcriptional Regulation      
Display Regulation             
Repressed by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter sbcCp2 415847 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lloyd RG., Buckman C., 1985, Identification and genetic analysis of sbcC mutations in commonly used recBC sbcB strains of Escherichia coli K-12., J Bacteriol 164(2):836-44

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB