RegulonDB RegulonDB 10.9: Gene Form
   

sdhB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sucA sdhA sdhB b0725 TSS_850 TSS_850 TSS_849 TSS_849 TSS_848 (cluster) TSS_848 (cluster) TSS_847 TSS_847 sucAp sucAp TSS_846 TSS_846 TSS_845 TSS_845 TSS_844 (cluster) TSS_844 (cluster) TSS_843 (cluster) TSS_843 (cluster) TSS_842 TSS_842

Gene      
Name: sdhB    Texpresso search in the literature
Synonym(s): ECK0713, EG10932, b0724, dhsB
Genome position(nucleotides): 757689 --> 758405 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.6
External database links:  
ASAP:
ABE-0002468
CGSC:
17905
ECHOBASE:
EB0925
ECOLIHUB:
sdhB
MIM:
115310
MIM:
171300
MIM:
606864
MIM:
612359
OU-MICROARRAY:
b0724
STRING:
511145.b0724
COLOMBOS: sdhB


Product      
Name: succinate:quinone oxidoreductase, iron-sulfur cluster binding protein
Synonym(s): DhsB, SdhB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.77
Isoelectric point: 6.707
Motif(s):
 
Type Positions Sequence
8 -> 97 YRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGL
139 -> 169 QREKLDGLYECILCACCSTSCPSFWWNPDKF
148 -> 221 ECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLN
5 -> 111 FSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0008177 - succinate dehydrogenase (ubiquinone) activity
GO:0051538 - 3 iron, 4 sulfur cluster binding
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0009060 - aerobic respiration
GO:0022904 - respiratory electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Condon C., et al., 1985
[2] Darlison MG., et al., 1984
External database links:  
DIP:
DIP-10836N
ECOCYC:
SDH-FE-S
ECOLIWIKI:
b0724
INTERPRO:
IPR009051
INTERPRO:
IPR017900
INTERPRO:
IPR001041
INTERPRO:
IPR004489
INTERPRO:
IPR025192
INTERPRO:
IPR036010
INTERPRO:
IPR017896
INTERPRO:
IPR012675
MODBASE:
P07014
PDB:
2WU2
PDB:
2WU5
PDB:
2WS3
PDB:
2WP9
PDB:
2WDV
PDB:
1NEK
PDB:
1NEN
PDB:
2ACZ
PDB:
2AD0
PDB:
2WDQ
PDB:
2WDR
PFAM:
PF13534
PFAM:
PF13085
PRIDE:
P07014
PRODB:
PRO_000023919
PROSITE:
PS51379
PROSITE:
PS00198
PROSITE:
PS51085
REFSEQ:
NP_415252
SMR:
P07014
UNIPROT:
P07014


Operon      
Name: sdhCDAB-sucABCD-sdhX         
Operon arrangement:
Transcription unit        Promoter
sdhCDAB-sucABCD-sdhX
sdhDAB
sucAB
sucABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, ArcA
Repressed by: FNR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_842 756352 forward nd [RS-EPT-CBR] [3]
  promoter TSS_843 (cluster) 758036 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_844 (cluster) 758044 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_845 758063 forward nd [RS-EPT-CBR] [3]
  promoter TSS_846 758585 forward nd [RS-EPT-CBR] [3]
  promoter TSS_847 761388 forward nd [RS-EPT-CBR] [3]
  promoter TSS_848 (cluster) 761444 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_849 761455 forward nd [RS-EPT-CBR] [3]
  promoter TSS_850 761476 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Condon C., Cammack R., Patil DS., Owen P., 1985, The succinate dehydrogenase of Escherichia coli. Immunochemical resolution and biophysical characterization of a 4-subunit enzyme complex., J Biol Chem 260(16):9427-34

 [2] Darlison MG., Guest JR., 1984, Nucleotide sequence encoding the iron-sulphur protein subunit of the succinate dehydrogenase of Escherichia coli., Biochem J 223(2):507-17

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB