RegulonDB RegulonDB 11.1: Gene Form
   

prlF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

garD agaR yhaV prlF TSS_3410 (cluster) TSS_3410 (cluster) sohAp sohAp TSS_3408 TSS_3408

Gene      
Name: prlF    Texpresso search in the literature
Synonym(s): ECK3117, EG10955, b3129, prlFA, sohA
Genome position(nucleotides): 3277002 --> 3277337
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.62
External database links:  
ASAP:
ABE-0010287
CGSC:
35411
ECHOBASE:
EB0948
ECOLIHUB:
sohA
OU-MICROARRAY:
b3129
STRING:
511145.b3129
COLOMBOS: prlF


Product      
Name: antitoxin PrlF
Synonym(s): PrlF, SohA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.359
Isoelectric point: 4.863
Motif(s):
 
Type Positions Sequence Comment
12 -> 59 TTESKVTIRGQTTIPAPVREALKLKPGQDSIHYEILPGGQVFMCRLGD UniProt: SpoVT-AbrB.
14 -> 110 ESKVTIRGQTTIPAPVREALKLKPGQDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNNPQKTRPFNIQQGKKLVAGMDVNIDDEIGDD
91 -> 111 QGKKLVAGMDVNIDDEIGDDE UniProt: In prlF1; suppresses overproduction lethality of lamB-lacZ gene fusions, leads to decreased beta-galactosidase activity. Partially alleviates YhaV toxic activity..

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0110001 - toxin-antitoxin complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0019899 - enzyme binding
GO:0003700 - DNA-binding transcription factor activity
GO:0042802 - identical protein binding
GO:0097351 - toxin sequestering activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0001558 - regulation of cell growth
GO:0040008 - regulation of growth
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [EXP-IDA-PURIFIED-PROTEIN] Assay of protein purified to homogeneity
Reference(s): [1] Schmidt O., et al., 2007
External database links:  
ALPHAFOLD:
P15373
ECOCYC:
EG10955-MONOMER
ECOLIWIKI:
b3129
INTERPRO:
IPR031848
INTERPRO:
IPR007159
INTERPRO:
IPR037914
PFAM:
PF15937
PRIDE:
P15373
PRODB:
PRO_000023966
PROSITE:
PS51740
REFSEQ:
NP_417598
SMR:
P15373
UNIPROT:
P15373


Operon      
Name: prlF-yhaV         
Operon arrangement:
Transcription unit        Promoter
sohA-yhaV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3408 3276940 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3410 (cluster) 3278324 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Schmidt O., Schuenemann VJ., Hand NJ., Silhavy TJ., Martin J., Lupas AN., Djuranovic S., 2007, prlF and yhaV Encode a New Toxin-Antitoxin System in Escherichia coli., J Mol Biol 372(4):894-905

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB